BLASTX nr result
ID: Mentha26_contig00048659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00048659 (476 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006493924.1| PREDICTED: wall-associated receptor kinase 2... 59 7e-07 ref|XP_006421432.1| hypothetical protein CICLE_v10004442mg [Citr... 58 2e-06 >ref|XP_006493924.1| PREDICTED: wall-associated receptor kinase 2-like [Citrus sinensis] Length = 760 Score = 58.9 bits (141), Expect = 7e-07 Identities = 38/112 (33%), Positives = 54/112 (48%), Gaps = 17/112 (15%) Frame = +1 Query: 28 LKTMISQAILVVMMVLL-------------DTGRCWESMPMPTFPTRCGDQAIPFPFRTS 168 LK +I +LVV+++LL T + P P RCGD IP+PF T Sbjct: 4 LKMLIRLIMLVVLVLLLLLAMGCRCSTSRTSTAAAAHAQAKPRCPNRCGDVEIPYPFGTK 63 Query: 169 SGYNLDYSSFVTCNYSYNPPKLFPDLGSLDVPGILDYGNFNV----ASDYYS 312 G L+ +TCN ++NPPK F +++V I G+ NV A D Y+ Sbjct: 64 RGCFLNKDFLITCNDTFNPPKPFLGESNINVVNISIDGHLNVLQYTAKDCYN 115 >ref|XP_006421432.1| hypothetical protein CICLE_v10004442mg [Citrus clementina] gi|557523305|gb|ESR34672.1| hypothetical protein CICLE_v10004442mg [Citrus clementina] Length = 716 Score = 57.8 bits (138), Expect = 2e-06 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 5/96 (5%) Frame = +1 Query: 43 SQAILVVMMVLLDTGRCWESMPMPTFPTRCGDQAIPFPFRTSSGYNLDYSSFVTCNYS-Y 219 ++ +++++++L + + P P P+RCGD IP+PF T G L+ +TCN + Y Sbjct: 7 TKLVVLLLVLLRASAAAAHAQPEPGCPSRCGDVEIPYPFGTRPGCFLNKYFVITCNETHY 66 Query: 220 NPPKLFPDLGSLDVPGILDYGNFNV----ASDYYSR 315 NPPK F +++V I G NV A D Y R Sbjct: 67 NPPKPFLGDSNVEVVNITTNGRMNVMHFNARDCYDR 102