BLASTX nr result
ID: Mentha26_contig00048456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00048456 (356 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN60732.1| hypothetical protein VITISV_010209 [Vitis vinifera] 61 2e-07 dbj|BAK64102.1| gag-pol polyprotein [Eustoma exaltatum subsp. ru... 57 2e-06 >emb|CAN60732.1| hypothetical protein VITISV_010209 [Vitis vinifera] Length = 1409 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/63 (42%), Positives = 34/63 (53%) Frame = +2 Query: 14 PHQPSPKATHKPVSGGGKEDKSHLWCTHCGKNKHTRETCFLRVGYPEWWDEKRARPQAKL 193 P P T KP GG CTHCG KHT+ETCF GYP+WW E +A+ + + Sbjct: 272 PSNGKPNTTTKPKGEGGG-------CTHCGNTKHTKETCFKLHGYPDWWHELKAKKKREA 324 Query: 194 AVG 202 + G Sbjct: 325 SGG 327 >dbj|BAK64102.1| gag-pol polyprotein [Eustoma exaltatum subsp. russellianum] Length = 1591 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/66 (40%), Positives = 35/66 (53%), Gaps = 5/66 (7%) Frame = +2 Query: 53 SGGGKEDKSHLWCTHCGKNKHTRETCFLRVGYPEWWDEKR-----ARPQAKLAVGTAVSN 217 + + DKS+L C HCGK H+RE CF GYPEWW+ KR + A G VS+ Sbjct: 290 NASSRMDKSNLLCEHCGKKGHSREKCFQIHGYPEWWEGKRITTGQGKTAAARTPGEGVSS 349 Query: 218 QREPLT 235 +T Sbjct: 350 NEAQMT 355