BLASTX nr result
ID: Mentha26_contig00048445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00048445 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004510890.1| PREDICTED: peroxisome biogenesis protein 16-... 76 6e-12 ref|XP_006445190.1| hypothetical protein CICLE_v10020702mg [Citr... 75 7e-12 ref|XP_006445188.1| hypothetical protein CICLE_v10020702mg [Citr... 75 7e-12 ref|XP_007051962.1| Shrunken seed protein (SSE1) [Theobroma caca... 75 7e-12 ref|XP_002320103.1| SHRUNKEN SEED 1 family protein [Populus tric... 75 9e-12 ref|XP_002272931.2| PREDICTED: peroxisome biogenesis protein 16-... 75 1e-11 ref|XP_002302555.2| hypothetical protein POPTR_0002s15370g [Popu... 74 3e-11 ref|XP_006386584.1| hypothetical protein POPTR_0002s15370g [Popu... 74 3e-11 ref|XP_004306862.1| PREDICTED: peroxisome biogenesis protein 16-... 74 3e-11 ref|XP_007134949.1| hypothetical protein PHAVU_010G089200g [Phas... 73 4e-11 ref|XP_006857955.1| hypothetical protein AMTR_s00069p00169360 [A... 73 4e-11 gb|EPS70344.1| hypothetical protein M569_04416 [Genlisea aurea] 73 4e-11 ref|XP_007219106.1| hypothetical protein PRUPE_ppa015596mg [Prun... 73 4e-11 ref|XP_003521407.1| PREDICTED: peroxisome biogenesis protein 16-... 72 6e-11 gb|EYU32036.1| hypothetical protein MIMGU_mgv1a009226mg [Mimulus... 72 1e-10 gb|EXC11737.1| hypothetical protein L484_020792 [Morus notabilis] 72 1e-10 emb|CAN81090.1| hypothetical protein VITISV_040910 [Vitis vinifera] 71 2e-10 ref|XP_004144990.1| PREDICTED: peroxisome biogenesis protein 16-... 70 2e-10 ref|XP_004952062.1| PREDICTED: peroxisome biogenesis protein 16-... 66 4e-09 gb|AFW66612.1| hypothetical protein ZEAMMB73_535866 [Zea mays] 66 4e-09 >ref|XP_004510890.1| PREDICTED: peroxisome biogenesis protein 16-like [Cicer arietinum] Length = 355 Score = 75.9 bits (185), Expect = 6e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 MEAYKRW+R NKDYVHSLESL NGLTW LPERFS+SEI Sbjct: 1 MEAYKRWVRENKDYVHSLESLANGLTWLLPERFSESEI 38 >ref|XP_006445190.1| hypothetical protein CICLE_v10020702mg [Citrus clementina] gi|568875798|ref|XP_006490977.1| PREDICTED: peroxisome biogenesis protein 16-like [Citrus sinensis] gi|557547452|gb|ESR58430.1| hypothetical protein CICLE_v10020702mg [Citrus clementina] Length = 369 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 M+AYKRW+RRN+DYVHSLESL NGLTW LPERFS+SEI Sbjct: 1 MDAYKRWVRRNRDYVHSLESLANGLTWLLPERFSESEI 38 >ref|XP_006445188.1| hypothetical protein CICLE_v10020702mg [Citrus clementina] gi|557547450|gb|ESR58428.1| hypothetical protein CICLE_v10020702mg [Citrus clementina] Length = 323 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 M+AYKRW+RRN+DYVHSLESL NGLTW LPERFS+SEI Sbjct: 1 MDAYKRWVRRNRDYVHSLESLANGLTWLLPERFSESEI 38 >ref|XP_007051962.1| Shrunken seed protein (SSE1) [Theobroma cacao] gi|508704223|gb|EOX96119.1| Shrunken seed protein (SSE1) [Theobroma cacao] Length = 365 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 MEAYK W+RRN+DYVHSLESL NGLTWFLPERFS SEI Sbjct: 1 MEAYKTWVRRNRDYVHSLESLANGLTWFLPERFSTSEI 38 >ref|XP_002320103.1| SHRUNKEN SEED 1 family protein [Populus trichocarpa] gi|222860876|gb|EEE98418.1| SHRUNKEN SEED 1 family protein [Populus trichocarpa] Length = 357 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 MEAYK+W+RRNKDYVHSLESL NGLTW LPERFS SEI Sbjct: 1 MEAYKKWVRRNKDYVHSLESLANGLTWLLPERFSASEI 38 >ref|XP_002272931.2| PREDICTED: peroxisome biogenesis protein 16-like [Vitis vinifera] gi|296089132|emb|CBI38835.3| unnamed protein product [Vitis vinifera] Length = 368 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 MEAYK+W+RRN+DYVHSLESL NGLTW LPERFS SEI Sbjct: 1 MEAYKKWVRRNRDYVHSLESLANGLTWLLPERFSSSEI 38 >ref|XP_002302555.2| hypothetical protein POPTR_0002s15370g [Populus trichocarpa] gi|550345077|gb|EEE81828.2| hypothetical protein POPTR_0002s15370g [Populus trichocarpa] Length = 385 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 ME YK+W+RRNKDYVHSLESL NGLTW LPERFS SEI Sbjct: 1 METYKKWVRRNKDYVHSLESLANGLTWLLPERFSASEI 38 >ref|XP_006386584.1| hypothetical protein POPTR_0002s15370g [Populus trichocarpa] gi|550345076|gb|ERP64381.1| hypothetical protein POPTR_0002s15370g [Populus trichocarpa] Length = 361 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 ME YK+W+RRNKDYVHSLESL NGLTW LPERFS SEI Sbjct: 1 METYKKWVRRNKDYVHSLESLANGLTWLLPERFSASEI 38 >ref|XP_004306862.1| PREDICTED: peroxisome biogenesis protein 16-like [Fragaria vesca subsp. vesca] Length = 367 Score = 73.6 bits (179), Expect = 3e-11 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 MEAYKRW+R NK+YVHSLESL NG+TW LPERFS+SEI Sbjct: 1 MEAYKRWVRENKEYVHSLESLANGITWLLPERFSESEI 38 >ref|XP_007134949.1| hypothetical protein PHAVU_010G089200g [Phaseolus vulgaris] gi|561007994|gb|ESW06943.1| hypothetical protein PHAVU_010G089200g [Phaseolus vulgaris] Length = 365 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 MEAYKRW+R+NK++VHSLESL NGLTW LPERFS+SEI Sbjct: 1 MEAYKRWVRQNKEFVHSLESLANGLTWLLPERFSESEI 38 >ref|XP_006857955.1| hypothetical protein AMTR_s00069p00169360 [Amborella trichopoda] gi|548862057|gb|ERN19422.1| hypothetical protein AMTR_s00069p00169360 [Amborella trichopoda] Length = 258 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 MEAYK+W+R+N++YVHSLESL NGLTWFLPERFS SEI Sbjct: 1 MEAYKQWVRKNREYVHSLESLANGLTWFLPERFSASEI 38 >gb|EPS70344.1| hypothetical protein M569_04416 [Genlisea aurea] Length = 355 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 MEAYKRW+ RN+DYVHSL SL NGLTW LPERFSDSEI Sbjct: 1 MEAYKRWLLRNRDYVHSLNSLANGLTWLLPERFSDSEI 38 >ref|XP_007219106.1| hypothetical protein PRUPE_ppa015596mg [Prunus persica] gi|462415568|gb|EMJ20305.1| hypothetical protein PRUPE_ppa015596mg [Prunus persica] Length = 366 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 MEAYK+W+R NKDYVHSLESL NG TW LPERFS+SEI Sbjct: 1 MEAYKKWVRENKDYVHSLESLANGFTWLLPERFSESEI 38 >ref|XP_003521407.1| PREDICTED: peroxisome biogenesis protein 16-like [Glycine max] Length = 366 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 MEAYKRW+R+NK++VHS+ESL NGLTW LPERFS+SEI Sbjct: 1 MEAYKRWVRQNKEFVHSMESLANGLTWLLPERFSESEI 38 >gb|EYU32036.1| hypothetical protein MIMGU_mgv1a009226mg [Mimulus guttatus] Length = 349 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 ME YKR++RRNKDYVHSLESL NGLTW LPERFS+SEI Sbjct: 1 MEYYKRFVRRNKDYVHSLESLANGLTWLLPERFSESEI 38 >gb|EXC11737.1| hypothetical protein L484_020792 [Morus notabilis] Length = 535 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 MEAYKRW+R NKDYV SLESL NGLTW LPERFS SEI Sbjct: 1 MEAYKRWVRENKDYVQSLESLANGLTWLLPERFSTSEI 38 >emb|CAN81090.1| hypothetical protein VITISV_040910 [Vitis vinifera] Length = 1109 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 203 AYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 AYK+W+RRN+DYVHSLESL NGLTW LPERFS SEI Sbjct: 747 AYKKWVRRNRDYVHSLESLANGLTWLLPERFSSSEI 782 >ref|XP_004144990.1| PREDICTED: peroxisome biogenesis protein 16-like [Cucumis sativus] gi|449471226|ref|XP_004153246.1| PREDICTED: peroxisome biogenesis protein 16-like [Cucumis sativus] gi|449522488|ref|XP_004168258.1| PREDICTED: peroxisome biogenesis protein 16-like [Cucumis sativus] Length = 369 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 MEAY++W+R N+DY+HS ESL NGLTW LPERFSDSEI Sbjct: 1 MEAYRKWVRDNRDYLHSFESLANGLTWLLPERFSDSEI 38 >ref|XP_004952062.1| PREDICTED: peroxisome biogenesis protein 16-like isoform X3 [Setaria italica] Length = 374 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 MEAYK W+RRN+D V SLESL NGLTW LPERF++SEI Sbjct: 1 MEAYKLWVRRNRDLVRSLESLANGLTWILPERFANSEI 38 >gb|AFW66612.1| hypothetical protein ZEAMMB73_535866 [Zea mays] Length = 313 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +2 Query: 197 MEAYKRWIRRNKDYVHSLESLTNGLTWFLPERFSDSEI 310 MEAYK W+RRN+D V SLESL NGLTW LPERF++SEI Sbjct: 1 MEAYKLWVRRNRDLVRSLESLANGLTWILPERFANSEI 38