BLASTX nr result
ID: Mentha26_contig00048327
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00048327 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18283.1| hypothetical protein MIMGU_mgv1a001017mg [Mimulus... 66 4e-09 gb|EYU43750.1| hypothetical protein MIMGU_mgv1a019836mg, partial... 65 1e-08 gb|EYU43751.1| hypothetical protein MIMGU_mgv1a026257mg, partial... 64 2e-08 gb|EYU18281.1| hypothetical protein MIMGU_mgv1a023807mg [Mimulus... 58 1e-06 gb|EYU43752.1| hypothetical protein MIMGU_mgv1a025517mg [Mimulus... 57 4e-06 ref|XP_007021577.1| Disease resistance protein family isoform 1 ... 57 4e-06 ref|XP_004234047.1| PREDICTED: disease resistance RPP8-like prot... 57 4e-06 >gb|EYU18283.1| hypothetical protein MIMGU_mgv1a001017mg [Mimulus guttatus] Length = 911 Score = 66.2 bits (160), Expect = 4e-09 Identities = 36/75 (48%), Positives = 48/75 (64%) Frame = -1 Query: 320 GSELEDDLMGYLAKFHNLRSLVLADDAFMGTDIVISSSPLFPKLRSLKLRNLRYLMKLTI 141 GSE +D M AKF NLRSLVL DAF+G +V S F +L SLKL L+YL + + Sbjct: 782 GSEFGEDPMPVFAKFPNLRSLVLCKDAFVGKKMVCSEPNHFLRLESLKLATLQYLEEWEV 841 Query: 140 EDGALPKLSSLQIER 96 ++ A+P+L + IER Sbjct: 842 DEAAMPRLVVITIER 856 >gb|EYU43750.1| hypothetical protein MIMGU_mgv1a019836mg, partial [Mimulus guttatus] Length = 883 Score = 65.1 bits (157), Expect = 1e-08 Identities = 38/97 (39%), Positives = 54/97 (55%) Frame = -1 Query: 320 GSELEDDLMGYLAKFHNLRSLVLADDAFMGTDIVISSSPLFPKLRSLKLRNLRYLMKLTI 141 GSEL+ D M L K L+SL + +DAF+G ++V S FP L+S KL N YL K T+ Sbjct: 784 GSELKVDPMQRLGKLSKLKSLDMRNDAFIGKEMVCHGSD-FPNLKSFKLVNFHYLEKWTV 842 Query: 140 EDGALPKLSSLQIERYGGALQLTISEELLYHRLKNEI 30 E A+PK+S++ IE+ H + NE+ Sbjct: 843 EPEAMPKVSTMWIEKCSKLSSTPAGRFEFAHNINNEL 879 >gb|EYU43751.1| hypothetical protein MIMGU_mgv1a026257mg, partial [Mimulus guttatus] Length = 768 Score = 64.3 bits (155), Expect = 2e-08 Identities = 37/75 (49%), Positives = 49/75 (65%) Frame = -1 Query: 320 GSELEDDLMGYLAKFHNLRSLVLADDAFMGTDIVISSSPLFPKLRSLKLRNLRYLMKLTI 141 GSELE D M + NLRSLVL DA++GT + + F +LRSLKLR+LR L + Sbjct: 639 GSELESDPMPIFGQIANLRSLVLCKDAYVGTGMKCGRTS-FGELRSLKLRSLRNLETWDV 697 Query: 140 EDGALPKLSSLQIER 96 E+GA+P+L L IE+ Sbjct: 698 EEGAMPQLMILSIEK 712 >gb|EYU18281.1| hypothetical protein MIMGU_mgv1a023807mg [Mimulus guttatus] Length = 553 Score = 58.2 bits (139), Expect = 1e-06 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 1/77 (1%) Frame = -1 Query: 323 HGSELEDDLMGYLAKFHNLRSLVLADDAFMGTDIVISSSPLFPKLRSLKLRNLRYLMKLT 144 +GSE +D M L K NLRSLVL +DAF+ T +V S FP L SL++ LR L K Sbjct: 429 NGSEYSEDPMPILGKLRNLRSLVLRNDAFVATKMVCSDESGFPHLTSLEISTLRLLEKWE 488 Query: 143 IE-DGALPKLSSLQIER 96 + + +P+L+ L IE+ Sbjct: 489 VRGEVFMPRLAILTIEK 505 >gb|EYU43752.1| hypothetical protein MIMGU_mgv1a025517mg [Mimulus guttatus] Length = 950 Score = 56.6 bits (135), Expect = 4e-06 Identities = 34/89 (38%), Positives = 51/89 (57%) Frame = -1 Query: 320 GSELEDDLMGYLAKFHNLRSLVLADDAFMGTDIVISSSPLFPKLRSLKLRNLRYLMKLTI 141 G+ELEDD M + NLRSL L++DA + + + F +LR+LKL+NLR L + Sbjct: 818 GAELEDDPMPVFGEIPNLRSLTLSNDACVRKKMDCLETG-FSQLRTLKLKNLRNLEVWDV 876 Query: 140 EDGALPKLSSLQIERYGGALQLTISEELL 54 E+G +P+L SL + G L + + L Sbjct: 877 EEGTMPQLMSLSVNNCGKLTMLPVGLKYL 905 >ref|XP_007021577.1| Disease resistance protein family isoform 1 [Theobroma cacao] gi|590609586|ref|XP_007021578.1| Disease resistance protein family isoform 1 [Theobroma cacao] gi|508721205|gb|EOY13102.1| Disease resistance protein family isoform 1 [Theobroma cacao] gi|508721206|gb|EOY13103.1| Disease resistance protein family isoform 1 [Theobroma cacao] Length = 224 Score = 56.6 bits (135), Expect = 4e-06 Identities = 34/74 (45%), Positives = 47/74 (63%) Frame = -1 Query: 320 GSELEDDLMGYLAKFHNLRSLVLADDAFMGTDIVISSSPLFPKLRSLKLRNLRYLMKLTI 141 G +LE+D + L K NLR L L ++AF G +V S+ FPKL SL L LR L +L + Sbjct: 85 GCKLEEDPLPTLEKLPNLRILKLDEEAFTGKKMVCSAE-CFPKLDSLSLLWLRNLEELKV 143 Query: 140 EDGALPKLSSLQIE 99 ++GA+P L L+IE Sbjct: 144 DEGAMPTLRHLEIE 157 >ref|XP_004234047.1| PREDICTED: disease resistance RPP8-like protein 3-like [Solanum lycopersicum] Length = 825 Score = 56.6 bits (135), Expect = 4e-06 Identities = 33/75 (44%), Positives = 50/75 (66%) Frame = -1 Query: 323 HGSELEDDLMGYLAKFHNLRSLVLADDAFMGTDIVISSSPLFPKLRSLKLRNLRYLMKLT 144 H S L+ D M L K +L L L DDA+MG D+V S+S FP+L+ L+L NL L ++ Sbjct: 727 HKSCLKQDPMPILEKLPSLGILGLNDDAYMGKDMVCSASG-FPQLKCLQLLNLSELQRIH 785 Query: 143 IEDGALPKLSSLQIE 99 +E+ A+P LS+++I+ Sbjct: 786 VENTAMPILSNIEID 800