BLASTX nr result
ID: Mentha26_contig00048050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00048050 (393 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61102.1| hypothetical protein M569_13698 [Genlisea aurea] 69 9e-10 gb|EYU40482.1| hypothetical protein MIMGU_mgv1a010385mg [Mimulus... 64 3e-08 ref|XP_006364350.1| PREDICTED: mitochondrial phosphate carrier p... 57 3e-06 >gb|EPS61102.1| hypothetical protein M569_13698 [Genlisea aurea] Length = 307 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 2 GPVVTMQWFLYDSFKLFTGLPASGGVKRHLKDAELLGY 115 GPVVT+QWF YDS K+ TGLP SGG++RHLKDA+ LGY Sbjct: 268 GPVVTLQWFFYDSIKMMTGLPTSGGLRRHLKDADFLGY 305 >gb|EYU40482.1| hypothetical protein MIMGU_mgv1a010385mg [Mimulus guttatus] Length = 313 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/37 (78%), Positives = 34/37 (91%), Gaps = 1/37 (2%) Frame = +2 Query: 2 GPVVTMQWFLYDSFKLFTGLPASGGVKRH-LKDAELL 109 GPVVT+QWFLYDS K+F GLPASGG++RH LKDAEL+ Sbjct: 275 GPVVTLQWFLYDSIKVFNGLPASGGLRRHILKDAELV 311 >ref|XP_006364350.1| PREDICTED: mitochondrial phosphate carrier protein 1, mitochondrial-like [Solanum tuberosum] Length = 311 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = +2 Query: 2 GPVVTMQWFLYDSFKLFTGLPASGGVKRHLKDAELL 109 GPV T+QWFLYD+ K+ TGLP SGG+ RH KD LL Sbjct: 274 GPVATLQWFLYDTIKVLTGLPTSGGLTRHEKDPNLL 309