BLASTX nr result
ID: Mentha26_contig00047930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00047930 (592 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25212.1| hypothetical protein MIMGU_mgv1a000037mg [Mimulus... 83 5e-14 >gb|EYU25212.1| hypothetical protein MIMGU_mgv1a000037mg [Mimulus guttatus] Length = 2208 Score = 83.2 bits (204), Expect = 5e-14 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 1/69 (1%) Frame = +2 Query: 380 MSAATGSGIHMRGGVGGGLVKAAPAPSHQLNAVSALSRKVRVSRAFAPKQR-VNLENRFV 556 MSA +GSGIH++GG GLVK APSHQLNAV+ALSR+VR S+ F KQR V LEN+FV Sbjct: 1 MSAVSGSGIHVKGG---GLVKPPCAPSHQLNAVAALSRRVRASQGFTAKQRTVRLENKFV 57 Query: 557 YGTKLRSSA 583 +GT L+S A Sbjct: 58 FGTSLKSGA 66