BLASTX nr result
ID: Mentha26_contig00047897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00047897 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41544.1| hypothetical protein MIMGU_mgv1a000267mg [Mimulus... 73 1e-17 >gb|EYU41544.1| hypothetical protein MIMGU_mgv1a000267mg [Mimulus guttatus] Length = 1326 Score = 72.8 bits (177), Expect(2) = 1e-17 Identities = 33/61 (54%), Positives = 48/61 (78%) Frame = -3 Query: 185 KYEPVFRNSFGRSMKHDLKATSAVTPQTVVTEVTAEEDRFPITPRDSVVHSPIQKPTFSE 6 K+EPVFRNSFGRS+KHD++AT+ +TP+ +AEE+R + P +SVVH+PI +P F+E Sbjct: 623 KFEPVFRNSFGRSIKHDVEATAPITPE------SAEENRLHVVPLNSVVHTPIPQPMFTE 676 Query: 5 E 3 + Sbjct: 677 D 677 Score = 42.4 bits (98), Expect(2) = 1e-17 Identities = 23/57 (40%), Positives = 32/57 (56%) Frame = -2 Query: 360 PKGSMQKPVNKARISPTTPDTKAIELEIQEASAGPMVSDISKSSLKPHDGVVESAKK 190 PKG+MQ P++K IS D K + E + A P+V D S S+ + VESA+K Sbjct: 565 PKGNMQSPMDKTAISLLMSDKKMVGHEAEVTPASPLVLDFSNSASEYQRSRVESAQK 621