BLASTX nr result
ID: Mentha26_contig00047886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00047886 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS72936.1| hypothetical protein M569_01817, partial [Genlise... 139 5e-31 gb|EYU21468.1| hypothetical protein MIMGU_mgv1a020382mg [Mimulus... 137 2e-30 ref|XP_006343080.1| PREDICTED: homeobox-leucine zipper protein G... 137 2e-30 ref|XP_004235676.1| PREDICTED: homeobox-leucine zipper protein G... 137 2e-30 gb|EXB74519.1| Homeobox-leucine zipper protein GLABRA 2 [Morus n... 135 6e-30 ref|XP_002304207.2| GLABRA 2 family protein [Populus trichocarpa... 135 6e-30 ref|XP_003543638.1| PREDICTED: homeobox-leucine zipper protein G... 134 1e-29 gb|AAC37514.1| homeodomain protein 1 [Helianthus annuus] 133 2e-29 ref|XP_007024190.1| HD-ZIP IV family of homeobox-leucine zipper ... 133 3e-29 ref|XP_007024189.1| HD-ZIP IV family of homeobox-leucine zipper ... 133 3e-29 gb|AAK19610.1|AF336277_1 BNLGHi8377 [Gossypium hirsutum] 133 3e-29 emb|CBI36129.3| unnamed protein product [Vitis vinifera] 133 3e-29 ref|XP_002284502.1| PREDICTED: homeobox-leucine zipper protein G... 133 3e-29 gb|AAM97321.1| homeodomain protein GhHOX1 [Gossypium hirsutum] 133 3e-29 ref|XP_006465622.1| PREDICTED: homeobox-leucine zipper protein G... 132 4e-29 ref|XP_007150635.1| hypothetical protein PHAVU_005G168900g [Phas... 132 4e-29 ref|XP_006426950.1| hypothetical protein CICLE_v10024950mg [Citr... 132 4e-29 ref|XP_007135673.1| hypothetical protein PHAVU_010G148700g [Phas... 132 5e-29 ref|XP_002516023.1| homeobox protein, putative [Ricinus communis... 132 7e-29 ref|XP_003546423.2| PREDICTED: homeobox-leucine zipper protein G... 131 9e-29 >gb|EPS72936.1| hypothetical protein M569_01817, partial [Genlisea aurea] Length = 473 Score = 139 bits (349), Expect = 5e-31 Identities = 65/72 (90%), Positives = 70/72 (97%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 +HRHTP QIR+ME LFKESPHPDEKQR+ELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE Sbjct: 76 HHRHTPDQIRKMEALFKESPHPDEKQRVELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 135 Query: 293 NSLLKSEIDKLR 328 NSLLK+EID+LR Sbjct: 136 NSLLKNEIDRLR 147 >gb|EYU21468.1| hypothetical protein MIMGU_mgv1a020382mg [Mimulus guttatus] Length = 742 Score = 137 bits (345), Expect = 2e-30 Identities = 64/72 (88%), Positives = 68/72 (94%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHTP QI EME LFKESPHPDE QRL+LSKQLGLHPRQVKFWFQNRRTQIKAIQERHE Sbjct: 86 YHRHTPEQITEMEALFKESPHPDENQRLQLSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 145 Query: 293 NSLLKSEIDKLR 328 NS+LK+E+DKLR Sbjct: 146 NSVLKTEMDKLR 157 >ref|XP_006343080.1| PREDICTED: homeobox-leucine zipper protein GLABRA 2-like [Solanum tuberosum] Length = 772 Score = 137 bits (344), Expect = 2e-30 Identities = 65/72 (90%), Positives = 68/72 (94%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHT QIREME LFKESPHPDEKQR +LSKQLGLHPRQVKFWFQNRRTQIKAIQERHE Sbjct: 116 YHRHTVQQIREMEALFKESPHPDEKQRQQLSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 175 Query: 293 NSLLKSEIDKLR 328 NSLLK+EI+KLR Sbjct: 176 NSLLKAEIEKLR 187 >ref|XP_004235676.1| PREDICTED: homeobox-leucine zipper protein GLABRA 2-like [Solanum lycopersicum] Length = 775 Score = 137 bits (344), Expect = 2e-30 Identities = 65/72 (90%), Positives = 68/72 (94%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHT QIREME LFKESPHPDEKQR +LSKQLGLHPRQVKFWFQNRRTQIKAIQERHE Sbjct: 115 YHRHTVQQIREMEALFKESPHPDEKQRQQLSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 174 Query: 293 NSLLKSEIDKLR 328 NSLLK+EI+KLR Sbjct: 175 NSLLKAEIEKLR 186 >gb|EXB74519.1| Homeobox-leucine zipper protein GLABRA 2 [Morus notabilis] Length = 755 Score = 135 bits (340), Expect = 6e-30 Identities = 66/72 (91%), Positives = 67/72 (93%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHT QIREME LFKESPHPDEKQR +LSKQLGL PRQVKFWFQNRRTQIKAIQERHE Sbjct: 104 YHRHTADQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIKAIQERHE 163 Query: 293 NSLLKSEIDKLR 328 NSLLKSEIDKLR Sbjct: 164 NSLLKSEIDKLR 175 >ref|XP_002304207.2| GLABRA 2 family protein [Populus trichocarpa] gi|550342441|gb|EEE79186.2| GLABRA 2 family protein [Populus trichocarpa] Length = 759 Score = 135 bits (340), Expect = 6e-30 Identities = 70/106 (66%), Positives = 73/106 (68%) Frame = +2 Query: 11 RSDDDYEAPXXXXXXXXXXXXXXXXXXXXXXXXXYHRHTPLQIREMETLFKESPHPDEKQ 190 RSDDD E YHRHT QIREME LFKESPHPDEKQ Sbjct: 75 RSDDDLEGEGEHDEDDGDGDGDDADKNKKKKRKKYHRHTAEQIREMEALFKESPHPDEKQ 134 Query: 191 RLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHENSLLKSEIDKLR 328 R +LSKQLGL PRQVKFWFQNRRTQIKAIQERHENSLLK+E+DKLR Sbjct: 135 RQQLSKQLGLAPRQVKFWFQNRRTQIKAIQERHENSLLKTEMDKLR 180 >ref|XP_003543638.1| PREDICTED: homeobox-leucine zipper protein GLABRA 2-like [Glycine max] Length = 762 Score = 134 bits (337), Expect = 1e-29 Identities = 69/106 (65%), Positives = 74/106 (69%) Frame = +2 Query: 11 RSDDDYEAPXXXXXXXXXXXXXXXXXXXXXXXXXYHRHTPLQIREMETLFKESPHPDEKQ 190 RS+DD+E YHRHT QIREME LFKESPHPDEKQ Sbjct: 77 RSEDDFEGGEAEPEDDDDAHGDNKNKKTKKKRKKYHRHTADQIREMEALFKESPHPDEKQ 136 Query: 191 RLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHENSLLKSEIDKLR 328 R +LSKQLGL PRQVKFWFQNRRTQIKAIQERHENSLLKSEI+KL+ Sbjct: 137 RQQLSKQLGLAPRQVKFWFQNRRTQIKAIQERHENSLLKSEIEKLK 182 >gb|AAC37514.1| homeodomain protein 1 [Helianthus annuus] Length = 682 Score = 133 bits (335), Expect = 2e-29 Identities = 63/71 (88%), Positives = 66/71 (92%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHT QIREME LFKESPHPDEKQR +LSK+LGLHPRQVKFWFQNRRTQIK IQERHE Sbjct: 99 YHRHTADQIREMEALFKESPHPDEKQRQQLSKRLGLHPRQVKFWFQNRRTQIKTIQERHE 158 Query: 293 NSLLKSEIDKL 325 NSLLKSE+DKL Sbjct: 159 NSLLKSELDKL 169 >ref|XP_007024190.1| HD-ZIP IV family of homeobox-leucine zipper protein with lipid-binding START domain isoform 2, partial [Theobroma cacao] gi|508779556|gb|EOY26812.1| HD-ZIP IV family of homeobox-leucine zipper protein with lipid-binding START domain isoform 2, partial [Theobroma cacao] Length = 597 Score = 133 bits (334), Expect = 3e-29 Identities = 64/72 (88%), Positives = 66/72 (91%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHT QIREME LFKESPHPDEKQR +LSKQLGL PRQVKFWFQNRRTQIKAIQERHE Sbjct: 101 YHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIKAIQERHE 160 Query: 293 NSLLKSEIDKLR 328 NSLLK E+DKLR Sbjct: 161 NSLLKHELDKLR 172 >ref|XP_007024189.1| HD-ZIP IV family of homeobox-leucine zipper protein with lipid-binding START domain isoform 1 [Theobroma cacao] gi|508779555|gb|EOY26811.1| HD-ZIP IV family of homeobox-leucine zipper protein with lipid-binding START domain isoform 1 [Theobroma cacao] Length = 753 Score = 133 bits (334), Expect = 3e-29 Identities = 64/72 (88%), Positives = 66/72 (91%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHT QIREME LFKESPHPDEKQR +LSKQLGL PRQVKFWFQNRRTQIKAIQERHE Sbjct: 101 YHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIKAIQERHE 160 Query: 293 NSLLKSEIDKLR 328 NSLLK E+DKLR Sbjct: 161 NSLLKHELDKLR 172 >gb|AAK19610.1|AF336277_1 BNLGHi8377 [Gossypium hirsutum] Length = 758 Score = 133 bits (334), Expect = 3e-29 Identities = 64/72 (88%), Positives = 66/72 (91%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHT QIREME LFKESPHPDEKQR +LSKQLGL PRQVKFWFQNRRTQIKAIQERHE Sbjct: 106 YHRHTADQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIKAIQERHE 165 Query: 293 NSLLKSEIDKLR 328 NSLLK E+DKLR Sbjct: 166 NSLLKQELDKLR 177 >emb|CBI36129.3| unnamed protein product [Vitis vinifera] Length = 750 Score = 133 bits (334), Expect = 3e-29 Identities = 64/72 (88%), Positives = 67/72 (93%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHT QIREME LFKESPHPDEKQR +LSKQLGL PRQVKFWFQNRRTQIKAIQERHE Sbjct: 98 YHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIKAIQERHE 157 Query: 293 NSLLKSEIDKLR 328 NSLLKSE++KLR Sbjct: 158 NSLLKSEMEKLR 169 >ref|XP_002284502.1| PREDICTED: homeobox-leucine zipper protein GLABRA 2-like [Vitis vinifera] Length = 754 Score = 133 bits (334), Expect = 3e-29 Identities = 64/72 (88%), Positives = 67/72 (93%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHT QIREME LFKESPHPDEKQR +LSKQLGL PRQVKFWFQNRRTQIKAIQERHE Sbjct: 102 YHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIKAIQERHE 161 Query: 293 NSLLKSEIDKLR 328 NSLLKSE++KLR Sbjct: 162 NSLLKSEMEKLR 173 >gb|AAM97321.1| homeodomain protein GhHOX1 [Gossypium hirsutum] Length = 753 Score = 133 bits (334), Expect = 3e-29 Identities = 64/72 (88%), Positives = 66/72 (91%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHT QIREME LFKESPHPDEKQR +LSKQLGL PRQVKFWFQNRRTQIKAIQERHE Sbjct: 101 YHRHTADQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIKAIQERHE 160 Query: 293 NSLLKSEIDKLR 328 NSLLK E+DKLR Sbjct: 161 NSLLKQELDKLR 172 >ref|XP_006465622.1| PREDICTED: homeobox-leucine zipper protein GLABRA 2-like [Citrus sinensis] Length = 764 Score = 132 bits (333), Expect = 4e-29 Identities = 64/72 (88%), Positives = 66/72 (91%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHT QIREME LFKESPHPDEKQR +LSKQLGL PRQVKFWFQNRRTQIK IQERHE Sbjct: 113 YHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIKTIQERHE 172 Query: 293 NSLLKSEIDKLR 328 NSLLKSEI+KLR Sbjct: 173 NSLLKSEIEKLR 184 >ref|XP_007150635.1| hypothetical protein PHAVU_005G168900g [Phaseolus vulgaris] gi|561023899|gb|ESW22629.1| hypothetical protein PHAVU_005G168900g [Phaseolus vulgaris] Length = 758 Score = 132 bits (333), Expect = 4e-29 Identities = 64/72 (88%), Positives = 67/72 (93%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHT QIREME LFKESPHPDEKQR +LSKQLGL PRQVKFWFQNRRTQIKAIQERHE Sbjct: 108 YHRHTADQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIKAIQERHE 167 Query: 293 NSLLKSEIDKLR 328 NSLLKSEI+KL+ Sbjct: 168 NSLLKSEIEKLK 179 >ref|XP_006426950.1| hypothetical protein CICLE_v10024950mg [Citrus clementina] gi|557528940|gb|ESR40190.1| hypothetical protein CICLE_v10024950mg [Citrus clementina] Length = 764 Score = 132 bits (333), Expect = 4e-29 Identities = 64/72 (88%), Positives = 66/72 (91%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHT QIREME LFKESPHPDEKQR +LSKQLGL PRQVKFWFQNRRTQIK IQERHE Sbjct: 113 YHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIKTIQERHE 172 Query: 293 NSLLKSEIDKLR 328 NSLLKSEI+KLR Sbjct: 173 NSLLKSEIEKLR 184 >ref|XP_007135673.1| hypothetical protein PHAVU_010G148700g [Phaseolus vulgaris] gi|561008718|gb|ESW07667.1| hypothetical protein PHAVU_010G148700g [Phaseolus vulgaris] Length = 748 Score = 132 bits (332), Expect = 5e-29 Identities = 63/72 (87%), Positives = 67/72 (93%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHT QIREME LFKESPHPDEKQR +LSKQLGL PRQVKFWFQNRRTQIKAIQERHE Sbjct: 99 YHRHTVEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIKAIQERHE 158 Query: 293 NSLLKSEIDKLR 328 NSLLK+E+DKL+ Sbjct: 159 NSLLKAELDKLK 170 >ref|XP_002516023.1| homeobox protein, putative [Ricinus communis] gi|223544928|gb|EEF46443.1| homeobox protein, putative [Ricinus communis] Length = 758 Score = 132 bits (331), Expect = 7e-29 Identities = 63/72 (87%), Positives = 67/72 (93%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHT QIREME LFKESPHPDEKQR +LSKQLGL PRQVKFWFQNRRTQIKAIQERHE Sbjct: 109 YHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIKAIQERHE 168 Query: 293 NSLLKSEIDKLR 328 NSLLK+E++KLR Sbjct: 169 NSLLKTEMEKLR 180 >ref|XP_003546423.2| PREDICTED: homeobox-leucine zipper protein GLABRA 2-like [Glycine max] Length = 751 Score = 131 bits (330), Expect = 9e-29 Identities = 63/72 (87%), Positives = 67/72 (93%) Frame = +2 Query: 113 YHRHTPLQIREMETLFKESPHPDEKQRLELSKQLGLHPRQVKFWFQNRRTQIKAIQERHE 292 YHRHT QI+EME LFKESPHPDEKQR +LSKQLGL PRQVKFWFQNRRTQIKAIQERHE Sbjct: 101 YHRHTADQIKEMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIKAIQERHE 160 Query: 293 NSLLKSEIDKLR 328 NSLLKSEI+KL+ Sbjct: 161 NSLLKSEIEKLK 172