BLASTX nr result
ID: Mentha26_contig00047818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00047818 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544513.1| PREDICTED: clathrin interactor EPSIN 1-like ... 58 2e-06 ref|XP_003550292.1| PREDICTED: clathrin interactor EPSIN 1 isofo... 57 2e-06 gb|EYU29308.1| hypothetical protein MIMGU_mgv1a004074mg [Mimulus... 56 6e-06 >ref|XP_003544513.1| PREDICTED: clathrin interactor EPSIN 1-like isoform 1 [Glycine max] Length = 564 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/57 (52%), Positives = 38/57 (66%) Frame = -2 Query: 307 GIVGGLTNASESKEKGPSPSFDMGIAMGAASGVSKSEVSNSTSAPVLDDVDFFSSLN 137 GIVGGL++ S+ +EKGP PSF MG AMG+ SG+ + S P D DFFSSL+ Sbjct: 498 GIVGGLSDGSDEREKGPPPSFYMGRAMGSGSGLGMGRSGFTPSQPAAGD-DFFSSLS 553 >ref|XP_003550292.1| PREDICTED: clathrin interactor EPSIN 1 isoform 1 [Glycine max] Length = 564 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/56 (51%), Positives = 38/56 (67%) Frame = -2 Query: 307 GIVGGLTNASESKEKGPSPSFDMGIAMGAASGVSKSEVSNSTSAPVLDDVDFFSSL 140 GIVGGL++ S+ +EKGP PSF MG AMG+ SG+ + S P+ D DFFS+L Sbjct: 498 GIVGGLSDGSDEREKGPPPSFYMGRAMGSGSGLGMGRSGFTPSQPIAGD-DFFSNL 552 >gb|EYU29308.1| hypothetical protein MIMGU_mgv1a004074mg [Mimulus guttatus] Length = 545 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/57 (54%), Positives = 34/57 (59%) Frame = -2 Query: 307 GIVGGLTNASESKEKGPSPSFDMGIAMGAASGVSKSEVSNSTSAPVLDDVDFFSSLN 137 GIVGGLT+ SE KEKGP P MG AMG S ST P + D DFFSSL+ Sbjct: 485 GIVGGLTDGSEEKEKGPPPPLQMGKAMGVGK-------SGSTPTPPIIDDDFFSSLS 534