BLASTX nr result
ID: Mentha26_contig00047790
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00047790 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002878736.1| potassium channel tetramerization domain-con... 97 2e-18 ref|NP_180001.1| BTB/POZ domain with WD40/YVTN repeat-containing... 97 2e-18 ref|XP_004287125.1| PREDICTED: BTB/POZ domain-containing protein... 97 2e-18 ref|XP_002532959.1| potassium channel tetramerization domain-con... 97 2e-18 ref|XP_006343658.1| PREDICTED: BTB/POZ domain-containing protein... 97 3e-18 ref|XP_006404929.1| hypothetical protein EUTSA_v10000165mg [Eutr... 97 3e-18 ref|XP_006295476.1| hypothetical protein CARUB_v10024579mg [Caps... 97 3e-18 ref|XP_004242586.1| PREDICTED: BTB/POZ domain-containing protein... 97 3e-18 gb|EXB24275.1| BTB/POZ domain-containing protein [Morus notabilis] 96 4e-18 ref|XP_007204503.1| hypothetical protein PRUPE_ppa019306mg [Prun... 96 4e-18 ref|XP_002309344.1| potassium channel tetramerisation domain-con... 96 4e-18 ref|XP_007011947.1| BTB/POZ domain with WD40/YVTN repeat-like pr... 96 5e-18 ref|XP_002324540.2| hypothetical protein POPTR_0018s11700g [Popu... 95 1e-17 ref|XP_006488209.1| PREDICTED: BTB/POZ domain-containing protein... 94 2e-17 ref|XP_006424690.1| hypothetical protein CICLE_v10028452mg [Citr... 94 2e-17 gb|EYU34353.1| hypothetical protein MIMGU_mgv1a025144mg [Mimulus... 94 2e-17 ref|XP_004146683.1| PREDICTED: BTB/POZ domain-containing protein... 94 2e-17 ref|XP_002265573.2| PREDICTED: BTB/POZ domain-containing protein... 93 3e-17 emb|CBI40938.3| unnamed protein product [Vitis vinifera] 93 3e-17 emb|CAN80633.1| hypothetical protein VITISV_006158 [Vitis vinifera] 93 3e-17 >ref|XP_002878736.1| potassium channel tetramerization domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297324575|gb|EFH54995.1| potassium channel tetramerization domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 440 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFDVWET P PI+ Sbjct: 393 PDWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDVWETPPCPII 440 >ref|NP_180001.1| BTB/POZ domain with WD40/YVTN repeat-containing protein [Arabidopsis thaliana] gi|75216782|sp|Q9ZUH1.1|Y2424_ARATH RecName: Full=BTB/POZ domain-containing protein At2g24240 gi|4115384|gb|AAD03385.1| unknown protein [Arabidopsis thaliana] gi|56236038|gb|AAV84475.1| At2g24240 [Arabidopsis thaliana] gi|56790194|gb|AAW30014.1| At2g24240 [Arabidopsis thaliana] gi|110738282|dbj|BAF01070.1| hypothetical protein [Arabidopsis thaliana] gi|330252453|gb|AEC07547.1| BTB/POZ domain with WD40/YVTN repeat-containing protein [Arabidopsis thaliana] Length = 441 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFDVWET P PI+ Sbjct: 394 PDWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDVWETPPCPII 441 >ref|XP_004287125.1| PREDICTED: BTB/POZ domain-containing protein At2g24240-like [Fragaria vesca subsp. vesca] Length = 446 Score = 97.1 bits (240), Expect = 2e-18 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFD+WET P PI+ Sbjct: 399 PDWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDIWETLPAPII 446 >ref|XP_002532959.1| potassium channel tetramerization domain-containing protein, putative [Ricinus communis] gi|223527269|gb|EEF29425.1| potassium channel tetramerization domain-containing protein, putative [Ricinus communis] Length = 444 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFDVWET P PI+ Sbjct: 397 PDWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDVWETTPPPII 444 >ref|XP_006343658.1| PREDICTED: BTB/POZ domain-containing protein At2g24240-like [Solanum tuberosum] Length = 441 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFD+WET P PI+ Sbjct: 394 PDWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDIWETSPPPII 441 >ref|XP_006404929.1| hypothetical protein EUTSA_v10000165mg [Eutrema salsugineum] gi|557106057|gb|ESQ46382.1| hypothetical protein EUTSA_v10000165mg [Eutrema salsugineum] Length = 440 Score = 96.7 bits (239), Expect = 3e-18 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFDVWET P PI+ Sbjct: 393 PDWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDVWETPPPPII 440 >ref|XP_006295476.1| hypothetical protein CARUB_v10024579mg [Capsella rubella] gi|482564184|gb|EOA28374.1| hypothetical protein CARUB_v10024579mg [Capsella rubella] Length = 440 Score = 96.7 bits (239), Expect = 3e-18 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFDVWET P PI+ Sbjct: 393 PDWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDVWETPPPPII 440 >ref|XP_004242586.1| PREDICTED: BTB/POZ domain-containing protein At2g24240-like [Solanum lycopersicum] Length = 441 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFD+WET P PI+ Sbjct: 394 PDWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDIWETSPPPII 441 >gb|EXB24275.1| BTB/POZ domain-containing protein [Morus notabilis] Length = 447 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFD+WET P PI+ Sbjct: 400 PDWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDIWETPPPPII 447 >ref|XP_007204503.1| hypothetical protein PRUPE_ppa019306mg [Prunus persica] gi|462400034|gb|EMJ05702.1| hypothetical protein PRUPE_ppa019306mg [Prunus persica] Length = 441 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFD+WET P PI+ Sbjct: 394 PDWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDIWETPPPPII 441 >ref|XP_002309344.1| potassium channel tetramerisation domain-containing family protein [Populus trichocarpa] gi|222855320|gb|EEE92867.1| potassium channel tetramerisation domain-containing family protein [Populus trichocarpa] Length = 446 Score = 96.3 bits (238), Expect = 4e-18 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPI 252 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFDVWET P PI Sbjct: 399 PDWVLTSRLRQSYGGSICDFSIGGDRLFALHSEENVFDVWETPPPPI 445 >ref|XP_007011947.1| BTB/POZ domain with WD40/YVTN repeat-like protein [Theobroma cacao] gi|508782310|gb|EOY29566.1| BTB/POZ domain with WD40/YVTN repeat-like protein [Theobroma cacao] Length = 444 Score = 95.9 bits (237), Expect = 5e-18 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFD+WET P P++ Sbjct: 397 PDWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDIWETPPPPVI 444 >ref|XP_002324540.2| hypothetical protein POPTR_0018s11700g [Populus trichocarpa] gi|550318531|gb|EEF03105.2| hypothetical protein POPTR_0018s11700g [Populus trichocarpa] Length = 527 Score = 94.7 bits (234), Expect = 1e-17 Identities = 43/47 (91%), Positives = 43/47 (91%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPI 252 PDWVLTSRLR YGGSICDFSIGGDRLFALHSEENVFDVWET P PI Sbjct: 480 PDWVLTSRLRQGYGGSICDFSIGGDRLFALHSEENVFDVWETPPPPI 526 >ref|XP_006488209.1| PREDICTED: BTB/POZ domain-containing protein At2g24240-like [Citrus sinensis] Length = 445 Score = 94.4 bits (233), Expect = 2e-17 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFD+WE P PI+ Sbjct: 398 PDWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDIWECPPSPII 445 >ref|XP_006424690.1| hypothetical protein CICLE_v10028452mg [Citrus clementina] gi|557526624|gb|ESR37930.1| hypothetical protein CICLE_v10028452mg [Citrus clementina] Length = 445 Score = 94.4 bits (233), Expect = 2e-17 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFD+WE P PI+ Sbjct: 398 PDWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDIWECPPSPII 445 >gb|EYU34353.1| hypothetical protein MIMGU_mgv1a025144mg [Mimulus guttatus] Length = 445 Score = 94.0 bits (232), Expect = 2e-17 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETR 264 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHS+ENVFD+WETR Sbjct: 398 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSDENVFDIWETR 440 >ref|XP_004146683.1| PREDICTED: BTB/POZ domain-containing protein At2g24240-like isoform 1 [Cucumis sativus] gi|449457897|ref|XP_004146684.1| PREDICTED: BTB/POZ domain-containing protein At2g24240-like isoform 2 [Cucumis sativus] gi|449519832|ref|XP_004166938.1| PREDICTED: BTB/POZ domain-containing protein At2g24240-like isoform 1 [Cucumis sativus] gi|449519834|ref|XP_004166939.1| PREDICTED: BTB/POZ domain-containing protein At2g24240-like isoform 2 [Cucumis sativus] Length = 446 Score = 94.0 bits (232), Expect = 2e-17 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR S GGSICDFSIGGDRLFALHSEENVFD+WET P PI+ Sbjct: 395 PDWVLTSRLRRSVGGSICDFSIGGDRLFALHSEENVFDIWETPPAPII 442 >ref|XP_002265573.2| PREDICTED: BTB/POZ domain-containing protein At2g24240 [Vitis vinifera] Length = 441 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFD+WET PI+ Sbjct: 394 PDWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDIWETPSPPII 441 >emb|CBI40938.3| unnamed protein product [Vitis vinifera] Length = 416 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFD+WET PI+ Sbjct: 369 PDWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDIWETPSPPII 416 >emb|CAN80633.1| hypothetical protein VITISV_006158 [Vitis vinifera] Length = 441 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -3 Query: 392 PDWVLTSRLRNSYGGSICDFSIGGDRLFALHSEENVFDVWETRPLPIM 249 PDWVLTSRLR SYGGSICDFSIGGDRLFALHSEENVFD+WET PI+ Sbjct: 394 PDWVLTSRLRRSYGGSICDFSIGGDRLFALHSEENVFDIWETPSPPII 441