BLASTX nr result
ID: Mentha26_contig00047619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00047619 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32333.1| hypothetical protein MIMGU_mgv1a016128mg [Mimulus... 74 3e-11 ref|XP_006353695.1| PREDICTED: uncharacterized protein LOC102589... 57 3e-06 >gb|EYU32333.1| hypothetical protein MIMGU_mgv1a016128mg [Mimulus guttatus] Length = 133 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/44 (75%), Positives = 43/44 (97%) Frame = -1 Query: 305 PKSPSDELISAVKQLLLKSLDSPRSSPVKKRCLLQSDTCFSALD 174 PK+P+ ELISAVKQLLL+SLDSPRSSPV+KRC+++S++CFSAL+ Sbjct: 89 PKNPTQELISAVKQLLLRSLDSPRSSPVRKRCMVRSESCFSALN 132 >ref|XP_006353695.1| PREDICTED: uncharacterized protein LOC102589140 [Solanum tuberosum] Length = 149 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/42 (66%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = -1 Query: 305 PKSPSDELISAVKQLLLKSLDSPRSSPVKKR-CLLQSDTCFS 183 P +P DELISAVKQL+ +SLDSPRSSPV++R L++S +CFS Sbjct: 105 PPNPKDELISAVKQLMFRSLDSPRSSPVRRRQGLVRSQSCFS 146