BLASTX nr result
ID: Mentha26_contig00047462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00047462 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32049.1| hypothetical protein MIMGU_mgv1a009260mg [Mimulus... 82 6e-14 >gb|EYU32049.1| hypothetical protein MIMGU_mgv1a009260mg [Mimulus guttatus] Length = 348 Score = 82.4 bits (202), Expect = 6e-14 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 1/62 (1%) Frame = -3 Query: 183 RPSTSPPAHDSLTAAAAGKHDDALPR-IRASATSEKKPKKQQDDYHSTLKALNSKGRFPR 7 R STSPPAHDSL AA+AGK R + AS TS++KPK Q+DDY STL+ALNSKGRFPR Sbjct: 18 RASTSPPAHDSLAAASAGKPPRTPSRKLSASTTSKRKPKVQEDDYRSTLEALNSKGRFPR 77 Query: 6 KS 1 KS Sbjct: 78 KS 79