BLASTX nr result
ID: Mentha26_contig00047386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00047386 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43693.1| hypothetical protein MIMGU_mgv1a009977mg [Mimulus... 61 1e-07 gb|EPS65285.1| hypothetical protein M569_09492 [Genlisea aurea] 57 3e-06 >gb|EYU43693.1| hypothetical protein MIMGU_mgv1a009977mg [Mimulus guttatus] Length = 325 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 342 CLCSVCGSGSHHLQACPVCNSSMTATLHVN 253 CLC VCGSGS LQACPVCNSSM ATLHVN Sbjct: 293 CLCGVCGSGSQQLQACPVCNSSMNATLHVN 322 >gb|EPS65285.1| hypothetical protein M569_09492 [Genlisea aurea] Length = 304 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 342 CLCSVCGSGSHHLQACPVCNSSMTATLHVNM 250 CLC++CGSGSH L+ACPVC+ M ATL+VNM Sbjct: 272 CLCNICGSGSHQLKACPVCDCPMNATLYVNM 302