BLASTX nr result
ID: Mentha26_contig00047339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00047339 (497 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263737.2| PREDICTED: cytochrome P450 93A3-like, partia... 62 6e-08 gb|EYU37093.1| hypothetical protein MIMGU_mgv1a026110mg, partial... 57 3e-06 >ref|XP_002263737.2| PREDICTED: cytochrome P450 93A3-like, partial [Vitis vinifera] Length = 456 Score = 62.4 bits (150), Expect = 6e-08 Identities = 35/86 (40%), Positives = 53/86 (61%), Gaps = 2/86 (2%) Frame = +1 Query: 244 VFFAHRRG--AASLVSCDRINMPWSEPDSQWRYTRRLFVQQMMSTRLFKESHHVRREAVR 417 + FA+R AA + S DR+++ WS S WR R+LFV++M+S + H RR VR Sbjct: 39 IIFANRDPPVAALISSYDRLDIVWSPYGSYWRNLRKLFVREMLSNNILDRCHAHRRYEVR 98 Query: 418 KTIGRLYAEMAGKPVEVGEISLGTEL 495 KTI +Y ++ G P++ G++S TEL Sbjct: 99 KTITNVYNKI-GTPMDFGKLSFQTEL 123 >gb|EYU37093.1| hypothetical protein MIMGU_mgv1a026110mg, partial [Mimulus guttatus] Length = 493 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/75 (41%), Positives = 45/75 (60%) Frame = +1 Query: 271 ASLVSCDRINMPWSEPDSQWRYTRRLFVQQMMSTRLFKESHHVRREAVRKTIGRLYAEMA 450 A+LV+ ++ W+ WR R+LFV++MMS + SH R E VRK IG L ++ Sbjct: 95 AALVATGGYDIVWTANGPYWRDIRKLFVREMMSNTNLQASHVFRTEEVRKLIGNLDTQI- 153 Query: 451 GKPVEVGEISLGTEL 495 G PV++GE+ TEL Sbjct: 154 GSPVQIGELIFLTEL 168