BLASTX nr result
ID: Mentha26_contig00047214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00047214 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19891.1| hypothetical protein MIMGU_mgv1a026881mg [Mimulus... 67 3e-09 ref|XP_006487711.1| PREDICTED: probable lysine-specific demethyl... 55 1e-05 >gb|EYU19891.1| hypothetical protein MIMGU_mgv1a026881mg [Mimulus guttatus] Length = 1188 Score = 67.0 bits (162), Expect = 3e-09 Identities = 36/69 (52%), Positives = 48/69 (69%), Gaps = 4/69 (5%) Frame = +3 Query: 12 SMKSEVTEDEEGRKRH----EKILDGLLKKASSEELQTLYSITHNKNPTDDEDRSLLTRL 179 ++KSE DE R EKIL+GL KA++EEL+ LYS+ HNK+ TD++ SLLT+L Sbjct: 1121 NVKSEPLNDEHNPSRSHPGVEKILNGLFNKANTEELRMLYSVLHNKSSTDEQ--SLLTKL 1178 Query: 180 LNQAIHKHP 206 L+ IHKHP Sbjct: 1179 LSDEIHKHP 1187 >ref|XP_006487711.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform X1 [Citrus sinensis] gi|568868957|ref|XP_006487712.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform X2 [Citrus sinensis] gi|568868959|ref|XP_006487713.1| PREDICTED: probable lysine-specific demethylase JMJ14-like isoform X3 [Citrus sinensis] Length = 1259 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/49 (59%), Positives = 33/49 (67%) Frame = +3 Query: 60 EKILDGLLKKASSEELQTLYSITHNKNPTDDEDRSLLTRLLNQAIHKHP 206 E IL GL KKAS EL LYSI +N P D+ SLL+RLLN+ IH HP Sbjct: 1212 ESILKGLFKKASPAELHVLYSIINNDKPATDQ--SLLSRLLNEEIHTHP 1258