BLASTX nr result
ID: Mentha26_contig00047212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00047212 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34972.1| hypothetical protein MIMGU_mgv1a001701mg [Mimulus... 69 7e-10 >gb|EYU34972.1| hypothetical protein MIMGU_mgv1a001701mg [Mimulus guttatus] Length = 770 Score = 68.9 bits (167), Expect = 7e-10 Identities = 36/50 (72%), Positives = 39/50 (78%) Frame = +2 Query: 227 MDSASSSLPLAARDGSPEAAATVEEDSTLSFVAGLAKEAALLFQAGKFLD 376 MDSASSSL DGSP AAA VE+D ++ AGLAKEAALLFQAGKFLD Sbjct: 1 MDSASSSLLFPPADGSPAAAAKVEDDGAMTVAAGLAKEAALLFQAGKFLD 50