BLASTX nr result
ID: Mentha26_contig00047067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00047067 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20652.1| hypothetical protein MIMGU_mgv1a0263781mg, partia... 78 1e-12 ref|XP_006340426.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_007015694.1| Tetratricopeptide repeat (TPR)-like superfam... 72 1e-10 ref|XP_007150033.1| hypothetical protein PHAVU_005G120400g [Phas... 71 2e-10 ref|XP_003541961.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 gb|EPS65182.1| hypothetical protein M569_09592 [Genlisea aurea] 69 7e-10 ref|XP_004251424.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 gb|EXC37761.1| hypothetical protein L484_001219 [Morus notabilis] 68 2e-09 ref|XP_002274209.2| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 emb|CBI24422.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_004293118.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_006481538.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_006424118.1| hypothetical protein CICLE_v10028449mg [Citr... 65 1e-08 ref|XP_004159118.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 64 2e-08 ref|XP_004139593.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_003559233.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_007220035.1| hypothetical protein PRUPE_ppb002505mg [Prun... 64 3e-08 emb|CBI38781.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_002270092.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 emb|CAN65443.1| hypothetical protein VITISV_011420 [Vitis vinifera] 64 3e-08 >gb|EYU20652.1| hypothetical protein MIMGU_mgv1a0263781mg, partial [Mimulus guttatus] Length = 216 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/66 (56%), Positives = 53/66 (80%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEIGMNVS 145 AS VR+ MK+RG+QK PGIS IE++G +++F AGDKSHA+AE IY++L++LS E+ + Sbjct: 147 ASNVRKTMKDRGVQKKPGISSIEVNGILNRFGAGDKSHADAESIYEMLEYLSEEL----T 202 Query: 144 VCEFDF 127 VC +DF Sbjct: 203 VCGYDF 208 >ref|XP_006340426.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Solanum tuberosum] Length = 509 Score = 71.6 bits (174), Expect = 1e-10 Identities = 37/68 (54%), Positives = 50/68 (73%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEIGMNVS 145 AS VR+KMK G+QK PGIS IE+DG +++F AGD+SH AE +Y +L+HLS E+ ++ Sbjct: 438 ASTVRKKMKALGIQKRPGISSIEVDGVLNEFVAGDRSHVHAEQVYAMLEHLSGELKVSGY 497 Query: 144 VCEFDFLE 121 V E DF E Sbjct: 498 V-EDDFSE 504 >ref|XP_007015694.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508786057|gb|EOY33313.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 509 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/51 (66%), Positives = 40/51 (78%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHL 172 ASKVRR+MK G+QK PG S IEI G +H+F AGDKSH E ECIYK+L+ L Sbjct: 437 ASKVRRRMKALGIQKKPGFSSIEISGCVHEFVAGDKSHLETECIYKMLELL 487 >ref|XP_007150033.1| hypothetical protein PHAVU_005G120400g [Phaseolus vulgaris] gi|561023297|gb|ESW22027.1| hypothetical protein PHAVU_005G120400g [Phaseolus vulgaris] Length = 514 Score = 70.9 bits (172), Expect = 2e-10 Identities = 37/64 (57%), Positives = 46/64 (71%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEIGMNVS 145 A+KVRR MK RG+QKIPG S IEID +IHKF AGDKSH E + +Y L+ LS E+ + Sbjct: 442 ANKVRRIMKERGIQKIPGFSSIEIDSSIHKFVAGDKSHEENDHVYAALELLSFELQLCGY 501 Query: 144 VCEF 133 V +F Sbjct: 502 VPDF 505 >ref|XP_003541961.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Glycine max] Length = 521 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/55 (61%), Positives = 42/55 (76%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEI 160 A+KVRR+MK RG+QK PG S IEID +IHKF +GDKSH E + IY L+ LS E+ Sbjct: 449 ANKVRRRMKERGIQKKPGFSSIEIDSSIHKFVSGDKSHEEKDHIYAALEFLSFEL 503 >gb|EPS65182.1| hypothetical protein M569_09592 [Genlisea aurea] Length = 579 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/55 (54%), Positives = 43/55 (78%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEI 160 A+ R+KMK+ GMQK PG+S IE+ G IHKF AGD+SH +++ IY L+H+S+E+ Sbjct: 425 AAHTRKKMKSLGMQKKPGLSTIEVSGFIHKFMAGDQSHVDSDTIYMTLKHVSDEL 479 >ref|XP_004251424.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Solanum lycopersicum] Length = 507 Score = 68.6 bits (166), Expect = 9e-10 Identities = 36/66 (54%), Positives = 48/66 (72%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEIGMNVS 145 AS VR+KMK G+QK PG S IEIDG +++F AGD+SH AE +Y +L+HLS E+ ++ Sbjct: 436 ASTVRKKMKALGIQKRPGTSSIEIDGVLNEFVAGDRSHLHAEQVYAMLEHLSGELKVSGY 495 Query: 144 VCEFDF 127 V E DF Sbjct: 496 V-EDDF 500 >gb|EXC37761.1| hypothetical protein L484_001219 [Morus notabilis] Length = 508 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEI 160 A KVR+ MK G+QK PG S IEID IH+F AGDKSH + CIY +L+ LS+E+ Sbjct: 439 AGKVRKTMKALGIQKTPGFSSIEIDCNIHEFVAGDKSHVDKNCIYSMLELLSSEL 493 >ref|XP_002274209.2| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Vitis vinifera] Length = 518 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/55 (58%), Positives = 41/55 (74%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEI 160 ASKVR+KMK G+ K PG S IE+DG+IH+F AGDK+H E + IY +L HL E+ Sbjct: 446 ASKVRKKMKALGIHKKPGFSSIEMDGSIHEFVAGDKTHVETQNIYAMLDHLFLEL 500 >emb|CBI24422.3| unnamed protein product [Vitis vinifera] Length = 502 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/55 (58%), Positives = 41/55 (74%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEI 160 ASKVR+KMK G+ K PG S IE+DG+IH+F AGDK+H E + IY +L HL E+ Sbjct: 430 ASKVRKKMKALGIHKKPGFSSIEMDGSIHEFVAGDKTHVETQNIYAMLDHLFLEL 484 >ref|XP_004293118.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 504 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/55 (60%), Positives = 41/55 (74%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEI 160 ASKVR+ MK+ G+QK PG S +EID IH+F AGDKSH +AE IY L+ LS E+ Sbjct: 437 ASKVRKTMKDLGIQKTPGFSSVEIDCDIHEFVAGDKSHVDAEYIYSTLELLSFEL 491 >ref|XP_006481538.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Citrus sinensis] Length = 509 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/55 (56%), Positives = 41/55 (74%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEI 160 A K+RR MK RG+QK PG+S IEI IH+F AGD+SH E+E IY +L+ LS ++ Sbjct: 437 AGKIRRTMKGRGIQKKPGLSSIEIGSGIHEFMAGDRSHIESEHIYSMLELLSFDL 491 >ref|XP_006424118.1| hypothetical protein CICLE_v10028449mg [Citrus clementina] gi|557526052|gb|ESR37358.1| hypothetical protein CICLE_v10028449mg [Citrus clementina] Length = 445 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/55 (56%), Positives = 41/55 (74%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEI 160 A K+RR MK RG+QK PG+S IEI IH+F AGD+SH E+E IY +L+ LS ++ Sbjct: 367 AGKIRRTMKGRGIQKKPGLSSIEIGSGIHEFMAGDRSHIESEHIYSMLELLSFDL 421 >ref|XP_004159118.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Cucumis sativus] Length = 525 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/55 (54%), Positives = 40/55 (72%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEI 160 A+ VRR MK RG+QK PG S +EIDG +H+F AGD HA+A+ IY +L L +E+ Sbjct: 449 ANNVRRTMKARGVQKKPGYSSVEIDGKVHEFVAGDNYHADADNIYSMLDLLCHEL 503 >ref|XP_004139593.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Cucumis sativus] Length = 525 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/55 (54%), Positives = 40/55 (72%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEI 160 A+ VRR MK RG+QK PG S +EIDG +H+F AGD HA+A+ IY +L L +E+ Sbjct: 449 ANNVRRTMKARGVQKKPGYSSVEIDGKVHEFVAGDNYHADADNIYSMLDLLCHEL 503 >ref|XP_003559233.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Brachypodium distachyon] Length = 611 Score = 63.9 bits (154), Expect = 2e-08 Identities = 24/54 (44%), Positives = 44/54 (81%) Frame = -3 Query: 321 SKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEI 160 S++RR+M RG++K+PG S++E+DG +H+F AGD+SH + + IY++++ +S E+ Sbjct: 462 SEIRREMSKRGIKKVPGCSLVELDGEVHEFIAGDESHPQYKEIYRMVEEMSREL 515 >ref|XP_007220035.1| hypothetical protein PRUPE_ppb002505mg [Prunus persica] gi|462416497|gb|EMJ21234.1| hypothetical protein PRUPE_ppb002505mg [Prunus persica] Length = 602 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/55 (49%), Positives = 39/55 (70%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEI 160 A K+RR MK + M+K PG S IE+DG +H+FK GDKSH ++ IYK+L + + + Sbjct: 540 AVKLRRAMKGKNMKKTPGCSSIELDGVVHEFKKGDKSHKRSKDIYKLLDEIMSHV 594 >emb|CBI38781.3| unnamed protein product [Vitis vinifera] Length = 589 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/58 (43%), Positives = 44/58 (75%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEIGMN 151 A K+R++MKN+G++K PG S IE++G IH+F AGD+SH + E IY +++ ++ + ++ Sbjct: 438 ALKLRKQMKNKGIEKTPGCSWIELNGMIHQFVAGDRSHLQTEQIYAMIEEMTRRVNLD 495 >ref|XP_002270092.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Vitis vinifera] Length = 687 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/58 (43%), Positives = 44/58 (75%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEIGMN 151 A K+R++MKN+G++K PG S IE++G IH+F AGD+SH + E IY +++ ++ + ++ Sbjct: 536 ALKLRKQMKNKGIEKTPGCSWIELNGMIHQFVAGDRSHLQTEQIYAMIEEMTRRVNLD 593 >emb|CAN65443.1| hypothetical protein VITISV_011420 [Vitis vinifera] Length = 485 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/58 (43%), Positives = 44/58 (75%) Frame = -3 Query: 324 ASKVRRKMKNRGMQKIPGISMIEIDGTIHKFKAGDKSHAEAECIYKILQHLSNEIGMN 151 A K+R++MKN+G++K PG S IE++G IH+F AGD+SH + E IY +++ ++ + ++ Sbjct: 334 ALKLRKQMKNKGIEKTPGCSWIELNGMIHQFVAGDRSHLQTEQIYAMIEEMTRRVNLD 391