BLASTX nr result
ID: Mentha26_contig00046781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00046781 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43282.1| hypothetical protein MIMGU_mgv1a023481mg [Mimulus... 58 2e-06 >gb|EYU43282.1| hypothetical protein MIMGU_mgv1a023481mg [Mimulus guttatus] Length = 368 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/67 (43%), Positives = 37/67 (55%) Frame = +3 Query: 162 MEIVKNVVEIVGFMCNSESWRMAVLWTISLVFSHXXXXXXXXXXXXXXXXPRSSLEDSIF 341 ME+ K+V+E FMCN + WRMAVLWT S++FS+ PR S +DSIF Sbjct: 1 MELGKSVIEGFNFMCNVQFWRMAVLWTFSIIFSYLKLFRESFFSQKSKCYPRFSPKDSIF 60 Query: 342 AAAMVPR 362 V R Sbjct: 61 TTKSVSR 67