BLASTX nr result
ID: Mentha26_contig00046772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00046772 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42573.1| hypothetical protein MIMGU_mgv1a014190mg [Mimulus... 65 1e-08 ref|XP_006443040.1| hypothetical protein CICLE_v10022331mg [Citr... 63 4e-08 gb|EXB68713.1| hypothetical protein L484_024733 [Morus notabilis] 60 2e-07 ref|XP_002534137.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 >gb|EYU42573.1| hypothetical protein MIMGU_mgv1a014190mg [Mimulus guttatus] Length = 198 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +1 Query: 220 MGTSSEDEYVAFLEKVQRTIYVDNLSPLVTEPVLRNAFNQF 342 MG S E+EY AFLEKV+RTIYVDNLSP VTE VL+ AFNQF Sbjct: 1 MGNSPEEEYDAFLEKVKRTIYVDNLSPQVTESVLKAAFNQF 41 >ref|XP_006443040.1| hypothetical protein CICLE_v10022331mg [Citrus clementina] gi|568849942|ref|XP_006478694.1| PREDICTED: uncharacterized protein LOC102617489 [Citrus sinensis] gi|557545302|gb|ESR56280.1| hypothetical protein CICLE_v10022331mg [Citrus clementina] Length = 199 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +1 Query: 220 MGTSSEDEYVAFLEKVQRTIYVDNLSPLVTEPVLRNAFNQF 342 MG+++E EY AFLEKV+RT+Y+DNLSP VTEPV+R A +QF Sbjct: 1 MGSTTEAEYAAFLEKVKRTVYLDNLSPQVTEPVIRTALDQF 41 >gb|EXB68713.1| hypothetical protein L484_024733 [Morus notabilis] Length = 199 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 220 MGTSSEDEYVAFLEKVQRTIYVDNLSPLVTEPVLRNAFNQF 342 MGT +++EY AF +KV+RT+Y+DNLSP VTE VLR A NQF Sbjct: 1 MGTPNKEEYAAFEDKVKRTVYIDNLSPRVTESVLRTALNQF 41 >ref|XP_002534137.1| conserved hypothetical protein [Ricinus communis] gi|223525795|gb|EEF28241.1| conserved hypothetical protein [Ricinus communis] Length = 263 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +1 Query: 220 MGTSSEDEYVAFLEKVQRTIYVDNLSPLVTEPVLRNAFNQF 342 M +++E E+ AFL+K++RT+YVDNLSP VTEPVLR A NQF Sbjct: 64 MESTAEAEFAAFLKKIERTVYVDNLSPHVTEPVLRTALNQF 104