BLASTX nr result
ID: Mentha26_contig00046721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00046721 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS58656.1| hypothetical protein M569_16158, partial [Genlise... 64 2e-08 ref|XP_002870709.1| binding protein [Arabidopsis lyrata subsp. l... 62 6e-08 ref|XP_006350584.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|NP_198856.2| pentatricopeptide repeat-containing protein [Ar... 58 1e-06 ref|XP_006282504.1| hypothetical protein CARUB_v10006941mg [Caps... 56 5e-06 >gb|EPS58656.1| hypothetical protein M569_16158, partial [Genlisea aurea] Length = 246 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/63 (49%), Positives = 46/63 (73%) Frame = -3 Query: 353 TSHKPITNPLYNFLPQSKNPNNLVALVCSSLYRKDHAALLDYLKDQGLFTRFTTLQFSTT 174 +S+KP+ NP+++FLP+ +NP NLV+LV SL +KD + L+ L++QGLF RF + S Sbjct: 1 SSNKPLPNPVFDFLPEIQNPCNLVSLVAPSLKQKDIFSSLNVLREQGLFHRFCSHDLSRV 60 Query: 173 LLR 165 LLR Sbjct: 61 LLR 63 >ref|XP_002870709.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297316545|gb|EFH46968.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 608 Score = 62.4 bits (150), Expect = 6e-08 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 3/71 (4%) Frame = -3 Query: 344 KPITNPLYNFLPQSKNPNNLVALVCSSLYRKDHAALLDYLKDQ--GLFTRFTTLQFSTTL 171 KPI NPLYN LPQ++NPN +V ++CS+L +DH+ LL L+D+ L + S L Sbjct: 25 KPILNPLYNLLPQTQNPNKIVDVICSTLNHRDHSVLLPNLRDEVKSLIPHLGYPEISRVL 84 Query: 170 LRF-LDSGRKL 141 LRF D+ R L Sbjct: 85 LRFQSDASRAL 95 >ref|XP_006350584.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like isoform X1 [Solanum tuberosum] gi|565367885|ref|XP_006350585.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like isoform X2 [Solanum tuberosum] gi|565367887|ref|XP_006350586.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like isoform X3 [Solanum tuberosum] gi|565367889|ref|XP_006350587.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like isoform X4 [Solanum tuberosum] gi|565367891|ref|XP_006350588.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like isoform X5 [Solanum tuberosum] Length = 629 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/65 (44%), Positives = 45/65 (69%), Gaps = 3/65 (4%) Frame = -3 Query: 350 SHKPITNPLYNFLPQSKNPNNLVALVCSSLYRK--DHAALLD-YLKDQGLFTRFTTLQFS 180 S +P +NPL+NFLP+++NP N V+L+CS+L + DH +LL ++D GL + F+ + S Sbjct: 45 SARPFSNPLHNFLPKTQNPQNTVSLICSALKNRNNDHLSLLQKTIQDNGLISYFSDSEIS 104 Query: 179 TTLLR 165 LLR Sbjct: 105 RVLLR 109 >ref|NP_198856.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171831|sp|Q9FND8.1|PP409_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g40400 gi|10178151|dbj|BAB11596.1| salt-inducible protein-like [Arabidopsis thaliana] gi|110742507|dbj|BAE99171.1| hypothetical protein [Arabidopsis thaliana] gi|332007160|gb|AED94543.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 610 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 2/63 (3%) Frame = -3 Query: 344 KPITNPLYNFLPQSKNPNNLVALVCSSLYRKDHAALLDYLKDQ--GLFTRFTTLQFSTTL 171 KPI NPLYN LPQS+NP+ +V ++CS+L D++ LL L+D+ L + S L Sbjct: 27 KPILNPLYNLLPQSQNPSKIVDVICSTLNHSDYSVLLPNLRDEVKSLIPHLGYPEISRVL 86 Query: 170 LRF 162 LRF Sbjct: 87 LRF 89 >ref|XP_006282504.1| hypothetical protein CARUB_v10006941mg [Capsella rubella] gi|482551209|gb|EOA15402.1| hypothetical protein CARUB_v10006941mg [Capsella rubella] Length = 615 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/71 (43%), Positives = 42/71 (59%), Gaps = 3/71 (4%) Frame = -3 Query: 344 KPITNPLYNFLPQSKNPNNLVALVCSSLYRKDHAALLDYLKD--QGLFTRFTTLQFSTTL 171 KPI NP YN LPQ++NPN +V ++CS+L +DH LL L+ + L + S L Sbjct: 28 KPIYNPFYNLLPQTQNPNKIVDVICSTLNHRDHLVLLPNLRGEVETLIPHLGYPEISRVL 87 Query: 170 LRF-LDSGRKL 141 LRF D+ R L Sbjct: 88 LRFQSDASRAL 98