BLASTX nr result
ID: Mentha26_contig00046708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00046708 (415 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004345357.1| hypothetical protein ACA1_355970 [Acanthamoe... 67 2e-09 ref|XP_004348357.1| hypothetical protein ACA1_325550 [Acanthamoe... 63 5e-08 >ref|XP_004345357.1| hypothetical protein ACA1_355970 [Acanthamoeba castellanii str. Neff] gi|440800189|gb|ELR21231.1| hypothetical protein ACA1_355970 [Acanthamoeba castellanii str. Neff] Length = 229 Score = 67.4 bits (163), Expect = 2e-09 Identities = 38/116 (32%), Positives = 60/116 (51%), Gaps = 6/116 (5%) Frame = +2 Query: 41 YWVFYQPDFFVCLYQPL-NRTIPKPDFANVTYYGKGLIDEYPVFHWGSR-----DAERRL 202 Y++FY+ D C L N+TI D ++ Y G L++ +PV+HW D +++ Sbjct: 92 YYIFYERDQVKCFTMDLKNKTIKGLDLSDADYKGMALVEYHPVYHWEKDIETKGDDKKKA 151 Query: 203 NYQVFDLQSNKRHIVRIDVDNERERRSETFTFHEFDLTRQDPSIFNIPAPVKSQCT 370 + +VFD Q + R I ++D E + + FHE + Q S+F IP V QCT Sbjct: 152 HIRVFDTQED-REIKKLDYSMHDENKIGSMLFHEVNYGPQADSLFKIPKLVMEQCT 206 >ref|XP_004348357.1| hypothetical protein ACA1_325550 [Acanthamoeba castellanii str. Neff] gi|440800957|gb|ELR21983.1| hypothetical protein ACA1_325550 [Acanthamoeba castellanii str. Neff] Length = 224 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/123 (26%), Positives = 60/123 (48%) Frame = +2 Query: 2 FANLYFDHAEKVEYWVFYQPDFFVCLYQPLNRTIPKPDFANVTYYGKGLIDEYPVFHWGS 181 F + +DH+E+ + VF++ + C + + + D + + GK + PV+HW Sbjct: 79 FHSFIYDHSEQKMFAVFFRGEVATCFTKTIRGNLTHFDLSEAEFLGKSYVYFDPVYHWQL 138 Query: 182 RDAERRLNYQVFDLQSNKRHIVRIDVDNERERRSETFTFHEFDLTRQDPSIFNIPAPVKS 361 R ++++FD R + ++ + ++ ++T HEFD QD S+F I VK Sbjct: 139 ETD--RYHFELFDTPEPHRELRKVSFFIKPNGKAGSWTMHEFDAGSQDESLFMINDKVKQ 196 Query: 362 QCT 370 CT Sbjct: 197 SCT 199