BLASTX nr result
ID: Mentha26_contig00046681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00046681 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541983.1| PREDICTED: alpha-L-fucosidase 1-like [Glycin... 59 9e-07 ref|XP_006424473.1| hypothetical protein CICLE_v10028210mg [Citr... 58 2e-06 ref|XP_006424472.1| hypothetical protein CICLE_v10028210mg [Citr... 58 2e-06 ref|XP_006488025.1| PREDICTED: alpha-L-fucosidase 1-like [Citrus... 57 3e-06 >ref|XP_003541983.1| PREDICTED: alpha-L-fucosidase 1-like [Glycine max] Length = 535 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = -2 Query: 386 LRLVFEKSRAEPLISYVGLYMDPFSIVQHMSELSSGSLINGIHAIQQATN 237 L+LV +KSRA+PLISY G+YMDP +I+ +S+ SG+ NG +Q TN Sbjct: 478 LKLVMDKSRADPLISYFGIYMDPVTILSDISDKKSGACFNGSQVLQTTTN 527 >ref|XP_006424473.1| hypothetical protein CICLE_v10028210mg [Citrus clementina] gi|557526407|gb|ESR37713.1| hypothetical protein CICLE_v10028210mg [Citrus clementina] Length = 521 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = -2 Query: 386 LRLVFEKSRAEPLISYVGLYMDPFSIVQHMSELSSGSLINGIHAIQQA 243 LR V +KSRAEPLIS+ G+YMD FSIV MS+ +S + +NG H +Q++ Sbjct: 464 LRFVIDKSRAEPLISHSGIYMDKFSIVSSMSDSTSQTSLNGSHILQKS 511 >ref|XP_006424472.1| hypothetical protein CICLE_v10028210mg [Citrus clementina] gi|557526406|gb|ESR37712.1| hypothetical protein CICLE_v10028210mg [Citrus clementina] Length = 442 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = -2 Query: 386 LRLVFEKSRAEPLISYVGLYMDPFSIVQHMSELSSGSLINGIHAIQQA 243 LR V +KSRAEPLIS+ G+YMD FSIV MS+ +S + +NG H +Q++ Sbjct: 385 LRFVIDKSRAEPLISHSGIYMDKFSIVSSMSDSTSQTSLNGSHILQKS 432 >ref|XP_006488025.1| PREDICTED: alpha-L-fucosidase 1-like [Citrus sinensis] Length = 521 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = -2 Query: 386 LRLVFEKSRAEPLISYVGLYMDPFSIVQHMSELSSGSLINGIHAIQQA 243 LR V +KSRAEPLIS++G+YMD FS V MS+ +S + +NG H +Q++ Sbjct: 464 LRFVIDKSRAEPLISHLGIYMDKFSTVSSMSDSTSQTSLNGSHILQKS 511