BLASTX nr result
ID: Mentha26_contig00046660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00046660 (496 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34297.1| hypothetical protein MIMGU_mgv1a014245mg [Mimulus... 56 4e-06 ref|XP_003549513.2| PREDICTED: transcription factor bHLH148-like... 55 1e-05 ref|XP_002308431.1| hypothetical protein POPTR_0006s19110g [Popu... 55 1e-05 >gb|EYU34297.1| hypothetical protein MIMGU_mgv1a014245mg [Mimulus guttatus] Length = 196 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +2 Query: 68 VLVPESCTNRRRALQRVVPGGEGMDGVSLLRETLDYIVALRAQVDVM 208 ++ + R R L+R+VPGGE MD VSL++ETLDYI +L+ QVDVM Sbjct: 132 IIAKKMVKKRTRVLKRLVPGGEQMDEVSLIKETLDYIASLQVQVDVM 178 >ref|XP_003549513.2| PREDICTED: transcription factor bHLH148-like [Glycine max] Length = 192 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +2 Query: 95 RRRALQRVVPGGEGMDGVSLLRETLDYIVALRAQVDVM 208 R R L+ ++PGGE MDGVSL+ ETLDYI +LRAQV+VM Sbjct: 129 RTRRLKSLLPGGESMDGVSLVEETLDYIQSLRAQVEVM 166 >ref|XP_002308431.1| hypothetical protein POPTR_0006s19110g [Populus trichocarpa] gi|222854407|gb|EEE91954.1| hypothetical protein POPTR_0006s19110g [Populus trichocarpa] Length = 186 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +2 Query: 95 RRRALQRVVPGGEGMDGVSLLRETLDYIVALRAQVDVM 208 R + L+ +VPGGE MD +SL+ ETLDYIV+LRAQVDVM Sbjct: 136 RTQVLKSLVPGGEFMDDISLIEETLDYIVSLRAQVDVM 173