BLASTX nr result
ID: Mentha26_contig00046477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00046477 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38688.1| hypothetical protein MIMGU_mgv1a020824mg [Mimulus... 66 4e-09 ref|XP_002264844.2| PREDICTED: BTB/POZ domain-containing protein... 66 6e-09 emb|CBI22784.3| unnamed protein product [Vitis vinifera] 66 6e-09 emb|CAN63084.1| hypothetical protein VITISV_015359 [Vitis vinifera] 66 6e-09 ref|XP_006430057.1| hypothetical protein CICLE_v10011740mg [Citr... 63 4e-08 ref|XP_006430058.1| hypothetical protein CICLE_v10011740mg [Citr... 62 1e-07 ref|XP_002309253.2| hypothetical protein POPTR_0006s21940g [Popu... 61 2e-07 ref|XP_006348459.1| PREDICTED: BTB/POZ domain-containing protein... 60 2e-07 ref|XP_007027985.1| Binding protein, putative [Theobroma cacao] ... 60 2e-07 ref|XP_004303398.1| PREDICTED: BTB/POZ domain-containing protein... 60 3e-07 ref|XP_004228910.1| PREDICTED: BTB/POZ domain-containing protein... 60 3e-07 ref|XP_006481601.1| PREDICTED: BTB/POZ domain-containing protein... 60 4e-07 ref|XP_006481602.1| PREDICTED: BTB/POZ domain-containing protein... 59 5e-07 ref|XP_002524054.1| protein binding protein, putative [Ricinus c... 58 2e-06 ref|XP_003521497.1| PREDICTED: BTB/POZ domain-containing protein... 55 8e-06 >gb|EYU38688.1| hypothetical protein MIMGU_mgv1a020824mg [Mimulus guttatus] Length = 443 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 293 MELSVTDNESRTPSRIGDRSTSDVVVRIRTQEGRDDWIYC 412 MELS DNES+ P +IGDRSTSDVVVRIRT EGRD+WIYC Sbjct: 1 MELS--DNESKEPLKIGDRSTSDVVVRIRTHEGRDEWIYC 38 >ref|XP_002264844.2| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Vitis vinifera] Length = 440 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 314 NESRTPSRIGDRSTSDVVVRIRTQEGRDDWIYC 412 NE+R PSRIGDR TSDVVVR+RTQEGRDDW+YC Sbjct: 6 NETRAPSRIGDRPTSDVVVRLRTQEGRDDWLYC 38 >emb|CBI22784.3| unnamed protein product [Vitis vinifera] Length = 262 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 314 NESRTPSRIGDRSTSDVVVRIRTQEGRDDWIYC 412 NE+R PSRIGDR TSDVVVR+RTQEGRDDW+YC Sbjct: 6 NETRAPSRIGDRPTSDVVVRLRTQEGRDDWLYC 38 >emb|CAN63084.1| hypothetical protein VITISV_015359 [Vitis vinifera] Length = 367 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 314 NESRTPSRIGDRSTSDVVVRIRTQEGRDDWIYC 412 NE+R PSRIGDR TSDVVVR+RTQEGRDDW+YC Sbjct: 6 NETRAPSRIGDRPTSDVVVRLRTQEGRDDWLYC 38 >ref|XP_006430057.1| hypothetical protein CICLE_v10011740mg [Citrus clementina] gi|557532114|gb|ESR43297.1| hypothetical protein CICLE_v10011740mg [Citrus clementina] Length = 440 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/39 (64%), Positives = 35/39 (89%) Frame = +2 Query: 296 ELSVTDNESRTPSRIGDRSTSDVVVRIRTQEGRDDWIYC 412 ++ + ++E + PS+IGDRSTSDVVVR+RTQ+GRDDW+YC Sbjct: 11 QIELENSEMQAPSKIGDRSTSDVVVRLRTQDGRDDWLYC 49 >ref|XP_006430058.1| hypothetical protein CICLE_v10011740mg [Citrus clementina] gi|567874939|ref|XP_006430059.1| hypothetical protein CICLE_v10011740mg [Citrus clementina] gi|557532115|gb|ESR43298.1| hypothetical protein CICLE_v10011740mg [Citrus clementina] gi|557532116|gb|ESR43299.1| hypothetical protein CICLE_v10011740mg [Citrus clementina] Length = 429 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +2 Query: 311 DNESRTPSRIGDRSTSDVVVRIRTQEGRDDWIYC 412 ++E + PS+IGDRSTSDVVVR+RTQ+GRDDW+YC Sbjct: 5 NSEMQAPSKIGDRSTSDVVVRLRTQDGRDDWLYC 38 >ref|XP_002309253.2| hypothetical protein POPTR_0006s21940g [Populus trichocarpa] gi|550336820|gb|EEE92776.2| hypothetical protein POPTR_0006s21940g [Populus trichocarpa] Length = 436 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 317 ESRTPSRIGDRSTSDVVVRIRTQEGRDDWIYC 412 ES PSRIGDRSTSDVVVR+RT EGRDDW YC Sbjct: 2 ESPEPSRIGDRSTSDVVVRLRTHEGRDDWFYC 33 >ref|XP_006348459.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform X1 [Solanum tuberosum] gi|565363471|ref|XP_006348460.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform X2 [Solanum tuberosum] gi|565363473|ref|XP_006348461.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform X3 [Solanum tuberosum] gi|565363475|ref|XP_006348462.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform X4 [Solanum tuberosum] gi|565363477|ref|XP_006348463.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform X5 [Solanum tuberosum] gi|565363479|ref|XP_006348464.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform X6 [Solanum tuberosum] gi|565363481|ref|XP_006348465.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform X7 [Solanum tuberosum] Length = 440 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +2 Query: 299 LSVTDNESRTPSRIGDRSTSDVVVRIRTQEGRDDWIYC 412 + NE +T S+IGDR TSDVVVR+RTQ+GRDDW+YC Sbjct: 1 METVPNELKTSSKIGDRPTSDVVVRLRTQDGRDDWLYC 38 >ref|XP_007027985.1| Binding protein, putative [Theobroma cacao] gi|508716590|gb|EOY08487.1| Binding protein, putative [Theobroma cacao] Length = 432 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +2 Query: 329 PSRIGDRSTSDVVVRIRTQEGRDDWIYC 412 PSRIGDRSTSDVVVR+RTQEGRD+WIYC Sbjct: 4 PSRIGDRSTSDVVVRLRTQEGRDEWIYC 31 >ref|XP_004303398.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Fragaria vesca subsp. vesca] Length = 446 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 311 DNESRTPSRIGDRSTSDVVVRIRTQEGRDDWIYC 412 D E RTPSRIGDRS SDVVVRIRTQ+ RD+W YC Sbjct: 11 DCERRTPSRIGDRSNSDVVVRIRTQDTRDEWFYC 44 >ref|XP_004228910.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Solanum lycopersicum] Length = 474 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 314 NESRTPSRIGDRSTSDVVVRIRTQEGRDDWIYC 412 NE +T S+IGDR TSDVVVR+RTQ+GRDDW+YC Sbjct: 40 NELKTSSKIGDRPTSDVVVRLRTQDGRDDWLYC 72 >ref|XP_006481601.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform X1 [Citrus sinensis] Length = 440 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = +2 Query: 296 ELSVTDNESRTPSRIGDRSTSDVVVRIRTQEGRDDWIYC 412 + + ++E + PS+IGDRSTSDVVVR+RTQ+ RDDW+YC Sbjct: 11 QTELENSEMQAPSKIGDRSTSDVVVRLRTQDSRDDWLYC 49 >ref|XP_006481602.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform X2 [Citrus sinensis] gi|568856050|ref|XP_006481603.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform X3 [Citrus sinensis] gi|568856052|ref|XP_006481604.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform X4 [Citrus sinensis] gi|568856054|ref|XP_006481605.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform X5 [Citrus sinensis] Length = 429 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +2 Query: 311 DNESRTPSRIGDRSTSDVVVRIRTQEGRDDWIYC 412 ++E + PS+IGDRSTSDVVVR+RTQ+ RDDW+YC Sbjct: 5 NSEMQAPSKIGDRSTSDVVVRLRTQDSRDDWLYC 38 >ref|XP_002524054.1| protein binding protein, putative [Ricinus communis] gi|223536622|gb|EEF38264.1| protein binding protein, putative [Ricinus communis] Length = 434 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 323 RTPSRIGDRSTSDVVVRIRTQEGRDDWIYC 412 + PSRIGDRSTSDVVVR+RT+E RDDW YC Sbjct: 2 KAPSRIGDRSTSDVVVRLRTEEARDDWFYC 31 >ref|XP_003521497.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform X1 [Glycine max] gi|571446454|ref|XP_006577100.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform X2 [Glycine max] Length = 440 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +2 Query: 317 ESRTPSRIGDRSTSDVVVRIRTQEGRDDWIYC 412 E + IGDRSTSDVVVR+RTQEGRDDW+YC Sbjct: 7 EEKIACVIGDRSTSDVVVRLRTQEGRDDWLYC 38