BLASTX nr result
ID: Mentha26_contig00046410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00046410 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34016.1| hypothetical protein MIMGU_mgv1a0176472mg, partia... 59 5e-07 gb|EYU34019.1| hypothetical protein MIMGU_mgv1a002019mg [Mimulus... 58 2e-06 >gb|EYU34016.1| hypothetical protein MIMGU_mgv1a0176472mg, partial [Mimulus guttatus] Length = 264 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = +1 Query: 1 FWGFVGCLVVKKSWRRAYFSFWDRIERGLYVNTSLFIAKFRRS 129 FWGFVG L++K+SWR AYF FW R+ YV T +F K RR+ Sbjct: 222 FWGFVGSLLIKRSWRVAYFDFWGRVGDWFYVTTIVFFGKLRRA 264 >gb|EYU34019.1| hypothetical protein MIMGU_mgv1a002019mg [Mimulus guttatus] Length = 725 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = +1 Query: 1 FWGFVGCLVVKKSWRRAYFSFWDRIERGLYVNTSLFIAKFRRS 129 FWGFVG L VK+SWR AY++FW R+ YV T +F K RR+ Sbjct: 683 FWGFVGSLFVKRSWRIAYYNFWGRVGDWFYVTTIVFFRKLRRA 725