BLASTX nr result
ID: Mentha26_contig00045834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00045834 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33638.1| hypothetical protein MIMGU_mgv1a010564mg [Mimulus... 68 1e-09 >gb|EYU33638.1| hypothetical protein MIMGU_mgv1a010564mg [Mimulus guttatus] Length = 308 Score = 68.2 bits (165), Expect = 1e-09 Identities = 41/80 (51%), Positives = 49/80 (61%), Gaps = 5/80 (6%) Frame = +3 Query: 3 NTNEP----FLTESAQNASVAKPFFNYGAGRMTELLQAVQENMKENQV-KIAENAPSASN 167 N+NEP F +ES N S AKP FNYG GRMTELLQA+QEN+KE +V +I E S N Sbjct: 230 NSNEPPPPPFSSESVANDSAAKPLFNYGTGRMTELLQALQENVKEKKVQQIGEQTASGFN 289 Query: 168 CDVHGTREEVKDPKSEASAP 227 TR E + + AS P Sbjct: 290 VGFQETRNE-NESTNGASVP 308