BLASTX nr result
ID: Mentha26_contig00045648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00045648 (434 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF08793.1|AF182828_1 geranyl diphosphate synthase large subu... 142 6e-32 gb|ABR15420.1| geranyl pyrophosphate synthase large subunit [Men... 139 5e-31 >gb|AAF08793.1|AF182828_1 geranyl diphosphate synthase large subunit [Mentha x piperita] gi|10637876|emb|CAC10561.1| gpp synthase large subunit [Mentha x piperita] gi|158979013|gb|ABW86879.1| geranyl pyrophosphate synthase large subunit [Mentha x piperita] Length = 377 Score = 142 bits (357), Expect = 6e-32 Identities = 69/79 (87%), Positives = 74/79 (93%) Frame = +3 Query: 198 MSALVNPVAKWPQTIGVKDVHGGRRRRSRSTLFQSHPLRTKLPFSLYFSSPIKGSASFSV 377 MSALVNPVAKWPQTIGVKDVHGGRRRRSRSTLFQSHPLRT++PFSLYFSSP+K A+FSV Sbjct: 1 MSALVNPVAKWPQTIGVKDVHGGRRRRSRSTLFQSHPLRTEMPFSLYFSSPLKAPATFSV 60 Query: 378 SAVYTKEDSEIRAEDPASS 434 SAVYTKE SEIR +DPA S Sbjct: 61 SAVYTKEGSEIRDKDPAPS 79 >gb|ABR15420.1| geranyl pyrophosphate synthase large subunit [Mentha canadensis] Length = 377 Score = 139 bits (349), Expect = 5e-31 Identities = 67/79 (84%), Positives = 73/79 (92%) Frame = +3 Query: 198 MSALVNPVAKWPQTIGVKDVHGGRRRRSRSTLFQSHPLRTKLPFSLYFSSPIKGSASFSV 377 MSALVNPVAKWPQTIG+KDVHGGRRRRSRSTLF SHPLRT++PFSLYFSSP+K A+FSV Sbjct: 1 MSALVNPVAKWPQTIGIKDVHGGRRRRSRSTLFLSHPLRTEMPFSLYFSSPLKAPATFSV 60 Query: 378 SAVYTKEDSEIRAEDPASS 434 SAVYTKE SEIR +DPA S Sbjct: 61 SAVYTKEGSEIRDKDPAPS 79