BLASTX nr result
ID: Mentha26_contig00045613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00045613 (448 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004230263.1| PREDICTED: F-box/LRR-repeat protein 3-like [... 95 1e-17 ref|XP_006344698.1| PREDICTED: F-box/LRR-repeat protein 3-like i... 91 2e-16 gb|EYU37277.1| hypothetical protein MIMGU_mgv1a017660mg [Mimulus... 89 5e-16 ref|XP_007031048.1| F-box family protein [Theobroma cacao] gi|50... 80 4e-13 ref|XP_004494950.1| PREDICTED: F-box/LRR-repeat protein 3-like [... 72 1e-10 ref|XP_006472139.1| PREDICTED: F-box/LRR-repeat protein 3-like i... 69 9e-10 ref|XP_006433468.1| hypothetical protein CICLE_v10000558mg [Citr... 69 9e-10 ref|XP_002318976.2| F-box family protein [Populus trichocarpa] g... 69 9e-10 ref|XP_006290009.1| hypothetical protein CARUB_v10003640mg [Caps... 69 9e-10 ref|XP_002872252.1| F-box family protein [Arabidopsis lyrata sub... 69 9e-10 ref|NP_568502.1| F-box protein [Arabidopsis thaliana] gi|2644957... 68 1e-09 ref|XP_002512464.1| ubiquitin-protein ligase, putative [Ricinus ... 68 1e-09 ref|XP_002279164.2| PREDICTED: uncharacterized protein LOC100249... 68 1e-09 emb|CBI39535.3| unnamed protein product [Vitis vinifera] 68 1e-09 ref|XP_006394932.1| hypothetical protein EUTSA_v10003812mg [Eutr... 67 2e-09 ref|XP_003626197.1| F-box/LRR-repeat protein [Medicago truncatul... 67 2e-09 ref|XP_003626196.1| F-box/LRR-repeat protein [Medicago truncatul... 67 2e-09 ref|XP_003626195.1| F-box/LRR-repeat protein [Medicago truncatul... 67 2e-09 ref|XP_006398589.1| hypothetical protein EUTSA_v10012898mg [Eutr... 67 3e-09 ref|XP_006398588.1| hypothetical protein EUTSA_v10012898mg [Eutr... 67 3e-09 >ref|XP_004230263.1| PREDICTED: F-box/LRR-repeat protein 3-like [Solanum lycopersicum] Length = 643 Score = 94.7 bits (234), Expect = 1e-17 Identities = 49/80 (61%), Positives = 55/80 (68%) Frame = +1 Query: 202 MDSAXXXXXXXXXXXXKIFSLLADDDSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPS 381 MDSA +I S + D SDRK+FRL CKAF RVDS HRTHLR+LRPEF+ + Sbjct: 1 MDSALLLSVLNEDLLIRILSFITHD-SDRKAFRLVCKAFLRVDSFHRTHLRILRPEFITT 59 Query: 382 LLSKLPRIASLDLSVCPSID 441 L SK PRI SLDLSVCP ID Sbjct: 60 LFSKFPRIYSLDLSVCPQID 79 >ref|XP_006344698.1| PREDICTED: F-box/LRR-repeat protein 3-like isoform X1 [Solanum tuberosum] gi|565355656|ref|XP_006344699.1| PREDICTED: F-box/LRR-repeat protein 3-like isoform X2 [Solanum tuberosum] Length = 641 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/55 (76%), Positives = 47/55 (85%) Frame = +1 Query: 277 DSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCPSID 441 DSDRK+FRL CKAF RVDS HRTHLR+LRPEF+ +L SK PRI SLDLSVCP I+ Sbjct: 23 DSDRKAFRLVCKAFLRVDSFHRTHLRILRPEFITTLFSKFPRIYSLDLSVCPQIN 77 >gb|EYU37277.1| hypothetical protein MIMGU_mgv1a017660mg [Mimulus guttatus] Length = 651 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/63 (68%), Positives = 49/63 (77%) Frame = +1 Query: 253 IFSLLADDDSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCP 432 I L +SDRKSFR TCK F RVDS+ RTH+R+LRPEF+ SLL KLPRI S+DLSVCP Sbjct: 19 IIGSLLSGESDRKSFRSTCKTFYRVDSVQRTHIRILRPEFISSLLFKLPRINSIDLSVCP 78 Query: 433 SID 441 ID Sbjct: 79 RID 81 >ref|XP_007031048.1| F-box family protein [Theobroma cacao] gi|508719653|gb|EOY11550.1| F-box family protein [Theobroma cacao] Length = 654 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/55 (69%), Positives = 44/55 (80%) Frame = +1 Query: 277 DSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCPSID 441 +SDRKSFRL C+ F+R+D L R HLRVLR EFLPSLL K P++ SLDLS CP ID Sbjct: 28 ESDRKSFRLVCREFHRIDLLTRKHLRVLRIEFLPSLLQKHPQLQSLDLSACPRID 82 >ref|XP_004494950.1| PREDICTED: F-box/LRR-repeat protein 3-like [Cicer arietinum] Length = 669 Score = 71.6 bits (174), Expect = 1e-10 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 9/72 (12%) Frame = +1 Query: 253 IFSLLADD---------DSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRI 405 +FSLL +D DSDRKS+RL CK FNRV+SL R ++R+LR EFL LL K I Sbjct: 34 LFSLLTEDLLIRILQKLDSDRKSWRLVCKDFNRVESLTRKNIRILRVEFLIGLLQKYCNI 93 Query: 406 ASLDLSVCPSID 441 LD S+CP ID Sbjct: 94 EMLDFSMCPRID 105 >ref|XP_006472139.1| PREDICTED: F-box/LRR-repeat protein 3-like isoform X2 [Citrus sinensis] Length = 611 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = +1 Query: 274 DDSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCPSID 441 D+ D K++RL CK F+RVDS+ RT LRVLR EFL LL K P I +LDLSVCP ++ Sbjct: 24 DELDSKTWRLVCKEFSRVDSVTRTTLRVLRVEFLFILLDKYPNIKTLDLSVCPRVN 79 >ref|XP_006433468.1| hypothetical protein CICLE_v10000558mg [Citrus clementina] gi|568836208|ref|XP_006472138.1| PREDICTED: F-box/LRR-repeat protein 3-like isoform X1 [Citrus sinensis] gi|557535590|gb|ESR46708.1| hypothetical protein CICLE_v10000558mg [Citrus clementina] Length = 643 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = +1 Query: 274 DDSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCPSID 441 D+ D K++RL CK F+RVDS+ RT LRVLR EFL LL K P I +LDLSVCP ++ Sbjct: 24 DELDSKTWRLVCKEFSRVDSVTRTTLRVLRVEFLFILLDKYPNIKTLDLSVCPRVN 79 >ref|XP_002318976.2| F-box family protein [Populus trichocarpa] gi|550324687|gb|EEE94899.2| F-box family protein [Populus trichocarpa] Length = 646 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/55 (60%), Positives = 41/55 (74%) Frame = +1 Query: 277 DSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCPSID 441 DSDRK++RL CK F+RVDS+ R LRVL EFLP+LL + +LDLSVCP I+ Sbjct: 27 DSDRKTWRLICKEFHRVDSITRKTLRVLHVEFLPTLLKNYTNLLTLDLSVCPCIE 81 >ref|XP_006290009.1| hypothetical protein CARUB_v10003640mg [Capsella rubella] gi|482558715|gb|EOA22907.1| hypothetical protein CARUB_v10003640mg [Capsella rubella] Length = 642 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = +1 Query: 274 DDSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCPSID 441 D RK++RL K F RVDSL RT +R+LR EFLP+LL K P ++SLDLSVCP +D Sbjct: 24 DPPCRKTWRLISKEFLRVDSLTRTTIRILRVEFLPALLLKYPNLSSLDLSVCPKLD 79 >ref|XP_002872252.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297318089|gb|EFH48511.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Length = 642 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = +1 Query: 274 DDSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCPSID 441 D RK++RL K F RVDSL RT +R+LR EFLP+LL K P ++SLDLSVCP +D Sbjct: 24 DPPCRKTWRLISKDFLRVDSLSRTTIRILRVEFLPTLLFKYPNLSSLDLSVCPKLD 79 >ref|NP_568502.1| F-box protein [Arabidopsis thaliana] gi|26449578|dbj|BAC41915.1| unknown protein [Arabidopsis thaliana] gi|29028992|gb|AAO64875.1| At5g27920 [Arabidopsis thaliana] gi|332006361|gb|AED93744.1| F-box protein [Arabidopsis thaliana] Length = 642 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = +1 Query: 274 DDSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCPSID 441 D RK++RL K F RVDSL RT +R+LR EFLP+LL K P ++SLDLSVCP +D Sbjct: 24 DPPCRKTWRLISKDFLRVDSLTRTTIRILRVEFLPTLLFKYPNLSSLDLSVCPKLD 79 >ref|XP_002512464.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223548425|gb|EEF49916.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 644 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = +1 Query: 277 DSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCPSIDAA 447 +SDRK+FRL CK F++++SL R LR+LR EFL LL K I SLDLSVCP ID A Sbjct: 25 ESDRKTFRLVCKEFHKIESLTRKTLRILRFEFLLPLLLKFNNIDSLDLSVCPRIDDA 81 >ref|XP_002279164.2| PREDICTED: uncharacterized protein LOC100249393 [Vitis vinifera] Length = 1700 Score = 67.8 bits (164), Expect = 1e-09 Identities = 35/55 (63%), Positives = 40/55 (72%) Frame = +1 Query: 283 DRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCPSIDAA 447 DRK++RL C+ F RVDS RT LRVLR EFLP LL K + SLDLSVCP I+ A Sbjct: 27 DRKTWRLVCRDFLRVDSACRTSLRVLRTEFLPGLLQKCRNMESLDLSVCPRINDA 81 >emb|CBI39535.3| unnamed protein product [Vitis vinifera] Length = 643 Score = 67.8 bits (164), Expect = 1e-09 Identities = 35/55 (63%), Positives = 40/55 (72%) Frame = +1 Query: 283 DRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCPSIDAA 447 DRK++RL C+ F RVDS RT LRVLR EFLP LL K + SLDLSVCP I+ A Sbjct: 27 DRKTWRLVCRDFLRVDSACRTSLRVLRTEFLPGLLQKCRNMESLDLSVCPRINDA 81 >ref|XP_006394932.1| hypothetical protein EUTSA_v10003812mg [Eutrema salsugineum] gi|557091571|gb|ESQ32218.1| hypothetical protein EUTSA_v10003812mg [Eutrema salsugineum] Length = 642 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = +1 Query: 274 DDSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCPSID 441 D + RK++RL + F RVDSL RT +RVLR EFLP LL K P ++SLDLSVCP +D Sbjct: 24 DPACRKTWRLISREFLRVDSLSRTSIRVLRVEFLPVLLFKYPYLSSLDLSVCPKLD 79 >ref|XP_003626197.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355501212|gb|AES82415.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 605 Score = 67.4 bits (163), Expect = 2e-09 Identities = 35/55 (63%), Positives = 40/55 (72%) Frame = +1 Query: 277 DSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCPSID 441 DSDRKSFRL CK F RV+S R +R+LR EFL +LL K I SLDLSVCP I+ Sbjct: 62 DSDRKSFRLVCKEFLRVESTTRKTIRILRIEFLLNLLQKYQNIESLDLSVCPWIE 116 >ref|XP_003626196.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355501211|gb|AES82414.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 623 Score = 67.4 bits (163), Expect = 2e-09 Identities = 35/55 (63%), Positives = 40/55 (72%) Frame = +1 Query: 277 DSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCPSID 441 DSDRKSFRL CK F RV+S R +R+LR EFL +LL K I SLDLSVCP I+ Sbjct: 62 DSDRKSFRLVCKEFLRVESTTRKTIRILRIEFLLNLLQKYQNIESLDLSVCPWIE 116 >ref|XP_003626195.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355501210|gb|AES82413.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 679 Score = 67.4 bits (163), Expect = 2e-09 Identities = 35/55 (63%), Positives = 40/55 (72%) Frame = +1 Query: 277 DSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCPSID 441 DSDRKSFRL CK F RV+S R +R+LR EFL +LL K I SLDLSVCP I+ Sbjct: 62 DSDRKSFRLVCKEFLRVESTTRKTIRILRIEFLLNLLQKYQNIESLDLSVCPWIE 116 >ref|XP_006398589.1| hypothetical protein EUTSA_v10012898mg [Eutrema salsugineum] gi|557099679|gb|ESQ40042.1| hypothetical protein EUTSA_v10012898mg [Eutrema salsugineum] Length = 667 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/62 (50%), Positives = 44/62 (70%) Frame = +1 Query: 253 IFSLLADDDSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCP 432 I L++++ SD KSF LTCK F +V++ HR L+ LRPE+LP LLS+ + A LDL+ CP Sbjct: 24 ILDLISENPSDLKSFSLTCKWFYQVEAKHRKSLKPLRPEYLPRLLSRYRKTADLDLTSCP 83 Query: 433 SI 438 + Sbjct: 84 RV 85 >ref|XP_006398588.1| hypothetical protein EUTSA_v10012898mg [Eutrema salsugineum] gi|557099678|gb|ESQ40041.1| hypothetical protein EUTSA_v10012898mg [Eutrema salsugineum] Length = 547 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/62 (50%), Positives = 44/62 (70%) Frame = +1 Query: 253 IFSLLADDDSDRKSFRLTCKAFNRVDSLHRTHLRVLRPEFLPSLLSKLPRIASLDLSVCP 432 I L++++ SD KSF LTCK F +V++ HR L+ LRPE+LP LLS+ + A LDL+ CP Sbjct: 24 ILDLISENPSDLKSFSLTCKWFYQVEAKHRKSLKPLRPEYLPRLLSRYRKTADLDLTSCP 83 Query: 433 SI 438 + Sbjct: 84 RV 85