BLASTX nr result
ID: Mentha26_contig00045434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00045434 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42166.1| hypothetical protein MIMGU_mgv1a000072mg [Mimulus... 79 5e-13 gb|EYU26433.1| hypothetical protein MIMGU_mgv1a0195131mg, partia... 79 8e-13 >gb|EYU42166.1| hypothetical protein MIMGU_mgv1a000072mg [Mimulus guttatus] Length = 1914 Score = 79.3 bits (194), Expect = 5e-13 Identities = 44/106 (41%), Positives = 60/106 (56%), Gaps = 2/106 (1%) Frame = +3 Query: 6 PYCESDPGVYEAYDLSKDVDKEAGTVKLIAMTIPKRPPTIDWKDEGNKQAPMFLRNEGSN 185 P+ E + ++YD SKD++ + TVKLI MT K+PP IDW E + + N G Sbjct: 810 PHHERSFDLSKSYDASKDINNDVETVKLIGMTFSKKPPIIDWTYEPESEGYVLPGNGGGK 869 Query: 186 MGMSIQGRATADDLLPFFERNFQEEQPPC--VSPRKLEPVDNHEAV 317 +G S++GR D LPFF N EE+ VSPR E +D+HE V Sbjct: 870 VGPSLEGR-FEDGCLPFFSTNSLEEEEKLQGVSPRNCEHIDSHELV 914 >gb|EYU26433.1| hypothetical protein MIMGU_mgv1a0195131mg, partial [Mimulus guttatus] Length = 1755 Score = 78.6 bits (192), Expect = 8e-13 Identities = 47/113 (41%), Positives = 62/113 (54%), Gaps = 8/113 (7%) Frame = +3 Query: 3 LPYCESDPGVYEAYD------LSKDVDKEAGTVKLIAMTIPKRPPTIDWKDEGNKQAPMF 164 LP E+ P ++D SKD++ EAGTV LI MT K+PP IDW E + + Sbjct: 683 LPQFENPPHHGRSFDSSKSCETSKDINNEAGTVNLIGMTFSKKPPIIDWTYEPESEGSVL 742 Query: 165 LRNEGSNMGMSIQGRATADDLLPFFERNF--QEEQPPCVSPRKLEPVDNHEAV 317 N GS G S++GR D +PFF N +EE+ VSPR E +D+HE V Sbjct: 743 PGNGGSKAGASLEGR-FEDGCIPFFSTNSLEEEEELQGVSPRNCEYIDSHELV 794