BLASTX nr result
ID: Mentha26_contig00045394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00045394 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554434.1| PREDICTED: cell division protein FtsZ homolo... 69 9e-10 emb|CAB89288.1| chloroplast FtsZ-like protein [Nicotiana tabacum] 68 2e-09 ref|NP_565839.1| cell division protein FtsZ homolog 2-1 [Arabido... 68 2e-09 ref|XP_006481783.1| PREDICTED: cell division protein FtsZ homolo... 68 2e-09 ref|XP_006481782.1| PREDICTED: cell division protein FtsZ homolo... 68 2e-09 ref|XP_006341140.1| PREDICTED: cell division protein FtsZ homolo... 68 2e-09 ref|XP_007162898.1| hypothetical protein PHAVU_001G189700g [Phas... 68 2e-09 ref|XP_006430212.1| hypothetical protein CICLE_v10011609mg [Citr... 68 2e-09 ref|XP_006410796.1| hypothetical protein EUTSA_v10016595mg [Eutr... 68 2e-09 ref|XP_004494173.1| PREDICTED: cell division protein FtsZ homolo... 68 2e-09 ref|XP_006294123.1| hypothetical protein CARUB_v10023118mg [Caps... 68 2e-09 ref|XP_006294122.1| hypothetical protein CARUB_v10023118mg [Caps... 68 2e-09 ref|XP_006291052.1| hypothetical protein CARUB_v10017167mg [Caps... 68 2e-09 ref|XP_004246890.1| PREDICTED: uncharacterized protein LOC101261... 68 2e-09 emb|CCH47171.1| similar to cell division protein ftsZ homolog 2-... 68 2e-09 gb|AAF23771.1|AF205859_1 FtsZ protein [Gentiana lutea] 68 2e-09 gb|AFK36357.1| unknown [Lotus japonicus] 68 2e-09 gb|AFC37492.1| FtsZ2 protein [Manihot esculenta] 68 2e-09 gb|AFB70893.1| FtsZ3 protein [Manihot esculenta] 68 2e-09 ref|XP_003521462.1| PREDICTED: cell division protein FtsZ homolo... 68 2e-09 >ref|XP_003554434.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like [Glycine max] Length = 478 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE+++ + I+ Sbjct: 351 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNVAAEVIY 392 >emb|CAB89288.1| chloroplast FtsZ-like protein [Nicotiana tabacum] Length = 468 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 340 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 381 >ref|NP_565839.1| cell division protein FtsZ homolog 2-1 [Arabidopsis thaliana] gi|42571077|ref|NP_973612.1| cell division protein FtsZ homolog 2-1 [Arabidopsis thaliana] gi|75220266|sp|O82533.2|FTZ21_ARATH RecName: Full=Cell division protein FtsZ homolog 2-1, chloroplastic; Short=AtFtsZ2-1; AltName: Full=Plastid division protein FTSZ2-1; Flags: Precursor gi|14195704|gb|AAC35987.2| plastid division protein FtsZ [Arabidopsis thaliana] gi|15292821|gb|AAK92779.1| putative plastid division protein FtsZ [Arabidopsis thaliana] gi|15636809|dbj|BAB68127.1| chloroplast division protein AtFtsZ2-1 [Arabidopsis thaliana] gi|20197938|gb|AAD21440.2| plastid division protein (FtsZ) [Arabidopsis thaliana] gi|20259559|gb|AAM14122.1| putative plastid division FtsZ protein [Arabidopsis thaliana] gi|330254127|gb|AEC09221.1| cell division protein FtsZ homolog 2-1 [Arabidopsis thaliana] gi|330254128|gb|AEC09222.1| cell division protein FtsZ homolog 2-1 [Arabidopsis thaliana] Length = 478 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 351 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 392 >ref|XP_006481783.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like isoform X2 [Citrus sinensis] gi|568856424|ref|XP_006481784.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like isoform X3 [Citrus sinensis] Length = 484 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 356 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 397 >ref|XP_006481782.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like isoform X1 [Citrus sinensis] Length = 484 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 356 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 397 >ref|XP_006341140.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like isoform X1 [Solanum tuberosum] gi|565348273|ref|XP_006341141.1| PREDICTED: cell division protein FtsZ homolog 2-2, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 477 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 349 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 390 >ref|XP_007162898.1| hypothetical protein PHAVU_001G189700g [Phaseolus vulgaris] gi|561036362|gb|ESW34892.1| hypothetical protein PHAVU_001G189700g [Phaseolus vulgaris] Length = 478 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 351 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 392 >ref|XP_006430212.1| hypothetical protein CICLE_v10011609mg [Citrus clementina] gi|567875247|ref|XP_006430213.1| hypothetical protein CICLE_v10011609mg [Citrus clementina] gi|557532269|gb|ESR43452.1| hypothetical protein CICLE_v10011609mg [Citrus clementina] gi|557532270|gb|ESR43453.1| hypothetical protein CICLE_v10011609mg [Citrus clementina] Length = 484 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 356 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 397 >ref|XP_006410796.1| hypothetical protein EUTSA_v10016595mg [Eutrema salsugineum] gi|557111965|gb|ESQ52249.1| hypothetical protein EUTSA_v10016595mg [Eutrema salsugineum] Length = 476 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 349 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 390 >ref|XP_004494173.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like [Cicer arietinum] Length = 495 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 369 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 410 >ref|XP_006294123.1| hypothetical protein CARUB_v10023118mg [Capsella rubella] gi|482562831|gb|EOA27021.1| hypothetical protein CARUB_v10023118mg [Capsella rubella] Length = 423 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 350 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 391 >ref|XP_006294122.1| hypothetical protein CARUB_v10023118mg [Capsella rubella] gi|482562830|gb|EOA27020.1| hypothetical protein CARUB_v10023118mg [Capsella rubella] Length = 477 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 350 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 391 >ref|XP_006291052.1| hypothetical protein CARUB_v10017167mg [Capsella rubella] gi|482559759|gb|EOA23950.1| hypothetical protein CARUB_v10017167mg [Capsella rubella] Length = 472 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 346 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 387 >ref|XP_004246890.1| PREDICTED: uncharacterized protein LOC101261060 [Solanum lycopersicum] Length = 1082 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 954 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 995 >emb|CCH47171.1| similar to cell division protein ftsZ homolog 2-1 [Lupinus angustifolius] Length = 519 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 392 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 433 >gb|AAF23771.1|AF205859_1 FtsZ protein [Gentiana lutea] Length = 483 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 354 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 395 >gb|AFK36357.1| unknown [Lotus japonicus] Length = 272 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 145 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 186 >gb|AFC37492.1| FtsZ2 protein [Manihot esculenta] Length = 485 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 357 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 398 >gb|AFB70893.1| FtsZ3 protein [Manihot esculenta] Length = 484 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 356 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 397 >ref|XP_003521462.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like [Glycine max] Length = 475 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 379 LNAIQSPLLDIGIGRATGIVWNITGGSDLTLFELDLGSLFIH 254 LNAIQSPLLDIGI RATGIVWNITGGSDLTLFE++ + I+ Sbjct: 348 LNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIY 389