BLASTX nr result
ID: Mentha26_contig00045392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00045392 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26995.1| hypothetical protein MIMGU_mgv1a005553mg [Mimulus... 60 2e-07 ref|XP_003541913.1| PREDICTED: uncharacterized protein LOC100807... 57 2e-06 ref|XP_003540357.1| PREDICTED: uncharacterized protein LOC100779... 57 3e-06 ref|XP_007149858.1| hypothetical protein PHAVU_005G104500g [Phas... 55 8e-06 >gb|EYU26995.1| hypothetical protein MIMGU_mgv1a005553mg [Mimulus guttatus] Length = 479 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -1 Query: 310 KSPELLDNCSMGFYFPQKSDEIYNQEYVAALKLLHFYRADD 188 KSPE+LDNCSMGF FP SDE+Y QE V +LKLL+FYRA D Sbjct: 440 KSPEVLDNCSMGFNFPPHSDEMY-QEKVVSLKLLYFYRACD 479 >ref|XP_003541913.1| PREDICTED: uncharacterized protein LOC100807746 [Glycine max] Length = 500 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -1 Query: 310 KSPELLDNCSMGFYFPQKSDEIYNQEYVAALKLLHFYRADD 188 KSPE+L NCS GF+FP +S+EI+ +E V + LLHFYRADD Sbjct: 457 KSPEVLQNCSTGFHFPSQSEEIF-EEKVEPINLLHFYRADD 496 >ref|XP_003540357.1| PREDICTED: uncharacterized protein LOC100779572 isoform X1 [Glycine max] gi|571494415|ref|XP_006592839.1| PREDICTED: uncharacterized protein LOC100779572 isoform X2 [Glycine max] Length = 501 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -1 Query: 310 KSPELLDNCSMGFYFPQKSDEIYNQEYVAALKLLHFYRADD 188 KSPE+L NCS GF+FP +S+EI+ +E V + LLHFYRADD Sbjct: 458 KSPEVLKNCSTGFHFPSQSEEIF-EEKVEPINLLHFYRADD 497 >ref|XP_007149858.1| hypothetical protein PHAVU_005G104500g [Phaseolus vulgaris] gi|561023122|gb|ESW21852.1| hypothetical protein PHAVU_005G104500g [Phaseolus vulgaris] Length = 498 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -1 Query: 310 KSPELLDNCSMGFYFPQKSDEIYNQEYVAALKLLHFYRAD 191 KSPE+L NCS GF+FP +S+EI+ +E V + LLHFYRAD Sbjct: 459 KSPEILQNCSTGFHFPSQSEEIF-EEKVEPINLLHFYRAD 497