BLASTX nr result
ID: Mentha26_contig00045287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00045287 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS65132.1| hypothetical protein M569_09641, partial [Genlise... 68 2e-09 gb|EYU45274.1| hypothetical protein MIMGU_mgv1a0014261mg, partia... 65 1e-08 ref|XP_006351947.1| PREDICTED: transmembrane protein 184C-like i... 57 3e-06 ref|XP_006351946.1| PREDICTED: transmembrane protein 184C-like i... 57 3e-06 gb|EYU26104.1| hypothetical protein MIMGU_mgv1a005113mg [Mimulus... 56 6e-06 >gb|EPS65132.1| hypothetical protein M569_09641, partial [Genlisea aurea] Length = 574 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 196 NKWTELFPSIVSRA*TLQVVHSEVPGHATGSIHLMYA 306 NKW ELFPSI+SRA TLQVVHSEV GHA+GS+HLMYA Sbjct: 161 NKWMELFPSIISRAKTLQVVHSEVSGHASGSLHLMYA 197 >gb|EYU45274.1| hypothetical protein MIMGU_mgv1a0014261mg, partial [Mimulus guttatus] Length = 676 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 196 NKWTELFPSIVSRA*TLQVVHSEVPGHATGSIHLMYA 306 NKW ELFPSI+SRA TLQ+VHSE GHA+GS+HLMYA Sbjct: 226 NKWMELFPSIISRAKTLQMVHSEASGHASGSLHLMYA 262 >ref|XP_006351947.1| PREDICTED: transmembrane protein 184C-like isoform X2 [Solanum tuberosum] Length = 313 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +2 Query: 107 MIIKAFTAISTVFLEAFDVFCEGDFKWNCG 196 MIIKAFTA V LE FDV+CEGDFKWNCG Sbjct: 177 MIIKAFTATLAVILEGFDVYCEGDFKWNCG 206 >ref|XP_006351946.1| PREDICTED: transmembrane protein 184C-like isoform X1 [Solanum tuberosum] Length = 490 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +2 Query: 107 MIIKAFTAISTVFLEAFDVFCEGDFKWNCG 196 MIIKAFTA V LE FDV+CEGDFKWNCG Sbjct: 177 MIIKAFTATLAVILEGFDVYCEGDFKWNCG 206 >gb|EYU26104.1| hypothetical protein MIMGU_mgv1a005113mg [Mimulus guttatus] Length = 496 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +2 Query: 107 MIIKAFTAISTVFLEAFDVFCEGDFKWNCG 196 MIIK FTA+S V LE F V+CEGDFKWNCG Sbjct: 180 MIIKLFTAVSAVILEGFGVYCEGDFKWNCG 209