BLASTX nr result
ID: Mentha26_contig00045203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00045203 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31998.1| hypothetical protein MIMGU_mgv1a016097mg [Mimulus... 68 1e-09 ref|XP_006345511.1| PREDICTED: protein cornichon homolog 4-like ... 65 1e-08 ref|XP_004240044.1| PREDICTED: probable protein cornichon homolo... 65 1e-08 ref|XP_004240043.1| PREDICTED: probable protein cornichon homolo... 65 1e-08 >gb|EYU31998.1| hypothetical protein MIMGU_mgv1a016097mg [Mimulus guttatus] Length = 134 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 396 QLPWEKKVRLCKLGYLVILLAMTIFWMIWSIVDE 295 QLPWEKKVRL KLGYLV+ LA+TIFWMIWSIVDE Sbjct: 101 QLPWEKKVRLYKLGYLVVFLALTIFWMIWSIVDE 134 >ref|XP_006345511.1| PREDICTED: protein cornichon homolog 4-like [Solanum tuberosum] Length = 134 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 396 QLPWEKKVRLCKLGYLVILLAMTIFWMIWSIVDE 295 QLPW+K+VRL KLGYLVILLA +IFWM+WSIVDE Sbjct: 101 QLPWDKRVRLYKLGYLVILLAFSIFWMVWSIVDE 134 >ref|XP_004240044.1| PREDICTED: probable protein cornichon homolog 2-like isoform 2 [Solanum lycopersicum] Length = 125 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 396 QLPWEKKVRLCKLGYLVILLAMTIFWMIWSIVDE 295 QLPW+KKVRL KLGYLVILLA +IFWM+WSIVD+ Sbjct: 90 QLPWDKKVRLYKLGYLVILLAFSIFWMVWSIVDD 123 >ref|XP_004240043.1| PREDICTED: probable protein cornichon homolog 2-like isoform 1 [Solanum lycopersicum] Length = 136 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 396 QLPWEKKVRLCKLGYLVILLAMTIFWMIWSIVDE 295 QLPW+KKVRL KLGYLVILLA +IFWM+WSIVD+ Sbjct: 101 QLPWDKKVRLYKLGYLVILLAFSIFWMVWSIVDD 134