BLASTX nr result
ID: Mentha26_contig00045153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00045153 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63168.1| hypothetical protein M569_11618, partial [Genlise... 56 4e-06 >gb|EPS63168.1| hypothetical protein M569_11618, partial [Genlisea aurea] Length = 873 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/34 (64%), Positives = 31/34 (91%) Frame = +3 Query: 6 RRSQWLDPREIEDEELPLTFADNMSIKKFSYKAK 107 RRS+W DPRE+E+EELPLTFAD +++K F+++AK Sbjct: 839 RRSKWRDPREVEEEELPLTFADTVTVKNFTFRAK 872