BLASTX nr result
ID: Mentha26_contig00044918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00044918 (457 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25779.1| hypothetical protein MIMGU_mgv1a0062851mg, partia... 68 2e-09 ref|XP_006453139.1| hypothetical protein CICLE_v10008130mg [Citr... 60 3e-07 ref|XP_007014587.1| Major facilitator superfamily protein, putat... 60 3e-07 ref|XP_007014586.1| Major facilitator superfamily protein, putat... 60 3e-07 ref|XP_006453135.1| hypothetical protein CICLE_v10008131mg [Citr... 59 5e-07 ref|XP_006453137.1| hypothetical protein CICLE_v10008136mg [Citr... 59 9e-07 ref|XP_006372262.1| hypothetical protein POPTR_0018s14760g [Popu... 58 1e-06 ref|XP_006474361.1| PREDICTED: organic cation/carnitine transpor... 57 3e-06 >gb|EYU25779.1| hypothetical protein MIMGU_mgv1a0062851mg, partial [Mimulus guttatus] Length = 377 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +1 Query: 331 MGDSDHVYSLDEALGMVGFGKYQGLMLAYGGLGYIADAMEIM 456 MGDS+ +Y++DEAL VGFGKYQ L+LAYGGLG+IA+AME+M Sbjct: 1 MGDSEGMYTVDEALSTVGFGKYQALLLAYGGLGWIAEAMELM 42 >ref|XP_006453139.1| hypothetical protein CICLE_v10008130mg [Citrus clementina] gi|567922268|ref|XP_006453140.1| hypothetical protein CICLE_v10008130mg [Citrus clementina] gi|568840820|ref|XP_006474363.1| PREDICTED: organic cation/carnitine transporter 7-like [Citrus sinensis] gi|557556365|gb|ESR66379.1| hypothetical protein CICLE_v10008130mg [Citrus clementina] gi|557556366|gb|ESR66380.1| hypothetical protein CICLE_v10008130mg [Citrus clementina] Length = 486 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = +1 Query: 331 MGDSDHVYSLDEALGMVGFGKYQGLMLAYGGLGYIADAMEIM 456 M + HVY++DEAL VGFGKYQ +LAY GLG++A+AMEIM Sbjct: 1 MAEQGHVYTVDEALTHVGFGKYQCFVLAYAGLGWVAEAMEIM 42 >ref|XP_007014587.1| Major facilitator superfamily protein, putative isoform 2 [Theobroma cacao] gi|508784950|gb|EOY32206.1| Major facilitator superfamily protein, putative isoform 2 [Theobroma cacao] Length = 486 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 352 YSLDEALGMVGFGKYQGLMLAYGGLGYIADAMEIM 456 Y+LDEAL MVGFGK+QGL+LAY GLG+ A+AMEIM Sbjct: 9 YTLDEALAMVGFGKFQGLVLAYAGLGWFAEAMEIM 43 >ref|XP_007014586.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma cacao] gi|508784949|gb|EOY32205.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma cacao] Length = 493 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 352 YSLDEALGMVGFGKYQGLMLAYGGLGYIADAMEIM 456 Y+LDEAL MVGFGK+QGL+LAY GLG+ A+AMEIM Sbjct: 16 YTLDEALAMVGFGKFQGLVLAYAGLGWFAEAMEIM 50 >ref|XP_006453135.1| hypothetical protein CICLE_v10008131mg [Citrus clementina] gi|568840822|ref|XP_006474364.1| PREDICTED: organic cation/carnitine transporter 7-like [Citrus sinensis] gi|557556361|gb|ESR66375.1| hypothetical protein CICLE_v10008131mg [Citrus clementina] Length = 485 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = +1 Query: 331 MGDSDHVYSLDEALGMVGFGKYQGLMLAYGGLGYIADAMEIM 456 MGD VY+LDEAL + FGKYQ L+LAY GLG++++AMEIM Sbjct: 1 MGDERPVYTLDEALSALRFGKYQALVLAYAGLGWVSEAMEIM 42 >ref|XP_006453137.1| hypothetical protein CICLE_v10008136mg [Citrus clementina] gi|568840824|ref|XP_006474365.1| PREDICTED: organic cation/carnitine transporter 7-like isoform X1 [Citrus sinensis] gi|568840826|ref|XP_006474366.1| PREDICTED: organic cation/carnitine transporter 7-like isoform X2 [Citrus sinensis] gi|557556363|gb|ESR66377.1| hypothetical protein CICLE_v10008136mg [Citrus clementina] Length = 485 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +1 Query: 331 MGDSDHVYSLDEALGMVGFGKYQGLMLAYGGLGYIADAMEIM 456 MGD VY LDEAL + FGKYQ L+LAY GLG++++AMEIM Sbjct: 1 MGDERPVYMLDEALSALRFGKYQALVLAYAGLGWVSEAMEIM 42 >ref|XP_006372262.1| hypothetical protein POPTR_0018s14760g [Populus trichocarpa] gi|550318793|gb|ERP50059.1| hypothetical protein POPTR_0018s14760g [Populus trichocarpa] Length = 507 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +1 Query: 331 MGDSDHVYSLDEALGMVGFGKYQGLMLAYGGLGYIADAMEIM 456 M D Y+LDEAL +GFGK+QGL+LAY GLG+ A+AME+M Sbjct: 15 MDDEAPAYTLDEALACLGFGKFQGLVLAYAGLGWFAEAMELM 56 >ref|XP_006474361.1| PREDICTED: organic cation/carnitine transporter 7-like isoform X1 [Citrus sinensis] Length = 493 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +1 Query: 331 MGDSDHVYSLDEALGMVGFGKYQGLMLAYGGLGYIADAMEIM 456 M D VY+LDEAL +GFGK+QGL LAY GLG+ ++AME+M Sbjct: 1 MDDHRLVYTLDEALTFMGFGKFQGLALAYSGLGWFSEAMEVM 42