BLASTX nr result
ID: Mentha26_contig00044810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00044810 (637 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAN20231.1| gamma-subunit,methylmalonyl-CoA decarboxylase, p... 74 5e-11 gb|ADD24270.1| Coiled-coil-helix-coiled-coil-helix domain-contai... 73 8e-11 gb|ACO11850.1| Coiled-coil-helix-coiled-coil-helix domain-contai... 73 8e-11 ref|XP_973308.2| PREDICTED: similar to gamma-subunit,methylmalon... 73 8e-11 gb|ACO15557.1| Coiled-coil-helix-coiled-coil-helix domain-contai... 72 1e-10 gb|ACO15043.1| Coiled-coil-helix-coiled-coil-helix domain-contai... 72 1e-10 ref|XP_001605485.1| PREDICTED: coiled-coil-helix-coiled-coil-hel... 72 1e-10 gb|EFA08694.1| hypothetical protein TcasGA2_TC006365 [Tribolium ... 71 2e-10 ref|XP_002605741.1| hypothetical protein BRAFLDRAFT_121867 [Bran... 70 5e-10 ref|XP_002431417.1| coiled-coil-helix-coiled-coil-helix domain-c... 69 9e-10 gb|EZA61706.1| Coiled-coil-helix-coiled-coil-helix domain-contai... 69 2e-09 ref|XP_005189847.1| PREDICTED: coiled-coil-helix-coiled-coil-hel... 69 2e-09 ref|XP_316875.5| AGAP000897-PA [Anopheles gambiae str. PEST] gi|... 68 3e-09 ref|XP_006614373.1| PREDICTED: coiled-coil-helix-coiled-coil-hel... 67 3e-09 ref|XP_391859.1| PREDICTED: coiled-coil-helix-coiled-coil-helix ... 67 3e-09 ref|XP_003691776.1| PREDICTED: coiled-coil-helix-coiled-coil-hel... 67 3e-09 gb|EFZ20925.1| hypothetical protein SINV_05574 [Solenopsis invicta] 67 3e-09 gb|EFN76558.1| Coiled-coil-helix-coiled-coil-helix domain-contai... 67 3e-09 gb|AEE61577.1| unknown [Dendroctonus ponderosae] gi|478256263|gb... 67 5e-09 ref|XP_003488284.1| PREDICTED: coiled-coil-helix-coiled-coil-hel... 67 5e-09 >dbj|BAN20231.1| gamma-subunit,methylmalonyl-CoA decarboxylase, putative [Riptortus pedestris] Length = 147 Score = 73.6 bits (179), Expect = 5e-11 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +2 Query: 185 TGPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEAN 298 TGPC+WEIKQFL+CA+ QSD+SLC+GFNEAIR CKE N Sbjct: 107 TGPCAWEIKQFLKCAQDQSDISLCAGFNEAIRQCKETN 144 >gb|ADD24270.1| Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial [Lepeophtheirus salmonis] Length = 156 Score = 72.8 bits (177), Expect = 8e-11 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +2 Query: 185 TGPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEANG 301 TGPC+WEIKQF+QCA+ QSD++LC GFNEA+R CK +NG Sbjct: 117 TGPCAWEIKQFIQCAQGQSDITLCEGFNEALRQCKSSNG 155 >gb|ACO11850.1| Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial precursor [Lepeophtheirus salmonis] gi|290462587|gb|ADD24341.1| Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial [Lepeophtheirus salmonis] Length = 154 Score = 72.8 bits (177), Expect = 8e-11 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +2 Query: 185 TGPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEANG 301 TGPC+WEIKQF+QCA+ QSD++LC GFNEA+R CK +NG Sbjct: 115 TGPCAWEIKQFIQCAQGQSDITLCEGFNEALRQCKSSNG 153 >ref|XP_973308.2| PREDICTED: similar to gamma-subunit,methylmalonyl-CoA decarboxylase, putative [Tribolium castaneum] Length = 156 Score = 72.8 bits (177), Expect = 8e-11 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 185 TGPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEANGV 304 TGPC+WEIKQFLQCA +QSDL+LC GFNEAI+ CK NGV Sbjct: 116 TGPCAWEIKQFLQCASTQSDLTLCQGFNEAIQQCKIRNGV 155 >gb|ACO15557.1| Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial precursor [Caligus clemensi] Length = 159 Score = 72.0 bits (175), Expect = 1e-10 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = +2 Query: 185 TGPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEANGV 304 TGPC+WEIKQF+QCA+ Q+D++LC GFNEA+R CK +NG+ Sbjct: 120 TGPCAWEIKQFIQCAQGQADITLCEGFNEALRQCKVSNGI 159 >gb|ACO15043.1| Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial precursor [Caligus clemensi] Length = 159 Score = 72.0 bits (175), Expect = 1e-10 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = +2 Query: 185 TGPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEANGV 304 TGPC+WEIKQF+QCA+ Q+D++LC GFNEA+R CK +NG+ Sbjct: 120 TGPCAWEIKQFIQCAQGQADITLCEGFNEALRQCKVSNGI 159 >ref|XP_001605485.1| PREDICTED: coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial-like [Nasonia vitripennis] Length = 149 Score = 72.0 bits (175), Expect = 1e-10 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = +2 Query: 185 TGPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEANGVAM 310 TG C+WE+KQFL+CA++QSDLSLC GFNEA+R CK AN +A+ Sbjct: 108 TGACAWEVKQFLECAQNQSDLSLCEGFNEALRQCKSANHLAL 149 >gb|EFA08694.1| hypothetical protein TcasGA2_TC006365 [Tribolium castaneum] Length = 136 Score = 71.2 bits (173), Expect = 2e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +2 Query: 185 TGPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEANG 301 TGPC+WEIKQFLQCA +QSDL+LC GFNEAI+ CK NG Sbjct: 98 TGPCAWEIKQFLQCASTQSDLTLCQGFNEAIQQCKIRNG 136 >ref|XP_002605741.1| hypothetical protein BRAFLDRAFT_121867 [Branchiostoma floridae] gi|229291076|gb|EEN61751.1| hypothetical protein BRAFLDRAFT_121867 [Branchiostoma floridae] Length = 1785 Score = 70.1 bits (170), Expect = 5e-10 Identities = 32/46 (69%), Positives = 36/46 (78%) Frame = +2 Query: 191 PCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEANGVAM*CDRLK 328 PC WEI+QFLQCA+SQSD+SLC GFNEAIR CK AN +RLK Sbjct: 107 PCGWEIQQFLQCAQSQSDISLCEGFNEAIRQCKVANVTNDELERLK 152 >ref|XP_002431417.1| coiled-coil-helix-coiled-coil-helix domain-containing protein, putative [Pediculus humanus corporis] gi|212516698|gb|EEB18679.1| coiled-coil-helix-coiled-coil-helix domain-containing protein, putative [Pediculus humanus corporis] Length = 160 Score = 69.3 bits (168), Expect = 9e-10 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +2 Query: 185 TGPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEANG 301 TG C+WEIKQFLQCA++QSDL+LC GFNEA+R CK ++G Sbjct: 118 TGACAWEIKQFLQCAQNQSDLTLCEGFNEALRQCKASHG 156 >gb|EZA61706.1| Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial [Cerapachys biroi] Length = 144 Score = 68.6 bits (166), Expect = 2e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 188 GPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEAN 298 G CSWE+KQFL+CA++QSDLSLC GFNEA+R CK AN Sbjct: 106 GACSWEVKQFLECAQNQSDLSLCEGFNEALRQCKVAN 142 >ref|XP_005189847.1| PREDICTED: coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial-like [Musca domestica] Length = 159 Score = 68.6 bits (166), Expect = 2e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 188 GPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACK 289 GPCSWEIKQFLQCA+ QSDL+LC GFNEA+R CK Sbjct: 121 GPCSWEIKQFLQCAQGQSDLTLCEGFNEALRQCK 154 >ref|XP_316875.5| AGAP000897-PA [Anopheles gambiae str. PEST] gi|333469471|gb|EAA12081.6| AGAP000897-PA [Anopheles gambiae str. PEST] Length = 154 Score = 67.8 bits (164), Expect = 3e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +2 Query: 185 TGPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACK 289 TGPCSWE+KQFL CA++QSDL+LC GFNEA+R CK Sbjct: 115 TGPCSWEMKQFLSCAQNQSDLTLCEGFNEALRQCK 149 >ref|XP_006614373.1| PREDICTED: coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial-like [Apis dorsata] Length = 146 Score = 67.4 bits (163), Expect = 3e-09 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +2 Query: 188 GPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEANGV 304 G C+WE+KQFL+CA +QSDL+LC GFNEA+R CK AN V Sbjct: 107 GACAWEVKQFLECANNQSDLTLCEGFNEALRQCKAANNV 145 >ref|XP_391859.1| PREDICTED: coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial-like [Apis mellifera] Length = 147 Score = 67.4 bits (163), Expect = 3e-09 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +2 Query: 188 GPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEANGV 304 G C+WE+KQFL+CA +QSDL+LC GFNEA+R CK AN V Sbjct: 108 GACAWEVKQFLECANNQSDLTLCEGFNEALRQCKAANNV 146 >ref|XP_003691776.1| PREDICTED: coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial-like [Apis florea] Length = 145 Score = 67.4 bits (163), Expect = 3e-09 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +2 Query: 188 GPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEANGV 304 G C+WE+KQFL+CA +QSDL+LC GFNEA+R CK AN V Sbjct: 106 GACAWEVKQFLECANNQSDLTLCEGFNEALRQCKAANNV 144 >gb|EFZ20925.1| hypothetical protein SINV_05574 [Solenopsis invicta] Length = 141 Score = 67.4 bits (163), Expect = 3e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 188 GPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEAN 298 G CSWE+KQFL+CA +QSDLSLC GFNEA+R CK AN Sbjct: 103 GACSWELKQFLECANNQSDLSLCQGFNEALRQCKMAN 139 >gb|EFN76558.1| Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial [Harpegnathos saltator] Length = 144 Score = 67.4 bits (163), Expect = 3e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 194 CSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEAN 298 CSWEIKQFL+CA++QSDLSLC GFNEA+R CK AN Sbjct: 108 CSWEIKQFLECAQNQSDLSLCEGFNEALRQCKAAN 142 >gb|AEE61577.1| unknown [Dendroctonus ponderosae] gi|478256263|gb|ENN76453.1| hypothetical protein YQE_06907, partial [Dendroctonus ponderosae] gi|546679245|gb|ERL89739.1| hypothetical protein D910_07100 [Dendroctonus ponderosae] Length = 155 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 185 TGPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEAN 298 +GPC+WEIKQFLQCA +QSDL+LC GFNEAI+ CK N Sbjct: 116 SGPCAWEIKQFLQCASTQSDLTLCQGFNEAIQQCKINN 153 >ref|XP_003488284.1| PREDICTED: coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial-like [Bombus impatiens] Length = 142 Score = 67.0 bits (162), Expect = 5e-09 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +2 Query: 188 GPCSWEIKQFLQCAESQSDLSLCSGFNEAIRACKEANGV 304 G C+WE+KQFL+CA++QSDLSLC GFNEA+R CK +N + Sbjct: 103 GACAWEVKQFLECAQNQSDLSLCEGFNEALRQCKASNNL 141