BLASTX nr result
ID: Mentha26_contig00044690
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00044690 (482 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42005.1| hypothetical protein MIMGU_mgv1a002009mg [Mimulus... 62 8e-08 >gb|EYU42005.1| hypothetical protein MIMGU_mgv1a002009mg [Mimulus guttatus] Length = 726 Score = 62.0 bits (149), Expect = 8e-08 Identities = 33/45 (73%), Positives = 34/45 (75%) Frame = +2 Query: 347 MGDLPVGGVAFAEPNRLEIGAENWAAAERTAGEIIRKVQPTSVSE 481 MGDLP GG A AEPN IG ENWAAA+R EIIRKVQPT VSE Sbjct: 1 MGDLPEGG-ATAEPNPFGIGTENWAAADRATLEIIRKVQPTPVSE 44