BLASTX nr result
ID: Mentha26_contig00044667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00044667 (1094 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC06430.1| hypothetical protein L484_004716 [Morus notabilis] 60 2e-06 >gb|EXC06430.1| hypothetical protein L484_004716 [Morus notabilis] Length = 176 Score = 60.1 bits (144), Expect = 2e-06 Identities = 33/93 (35%), Positives = 48/93 (51%) Frame = +1 Query: 211 GRESKNFVTLSDMGDFRCYYDVPSHIVFHVPVENVRADWDLPGMTCLYEFPFRVGFRFPL 390 G +S FVT D+ + Y +P I E+ RAD G LYEF +G +FPL Sbjct: 56 GDDSAFFVTAEDVKSWWKEYGIPKEIKLRASNEDERADEPRDGWFALYEFFLMIGMKFPL 115 Query: 391 PNLIEQVCGYYHIAPGQLTPNSWCSLMAIEVLQ 489 P L +V ++ I GQL PNS S++ + ++ Sbjct: 116 PRLGSEVPRHFKIVIGQLMPNSMNSMLQVTAIR 148