BLASTX nr result
ID: Mentha26_contig00044423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00044423 (431 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264946.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Viti... 103 2e-20 gb|EPS59190.1| hypothetical protein M569_15620, partial [Genlise... 101 9e-20 gb|EYU42844.1| hypothetical protein MIMGU_mgv1a007948mg [Mimulus... 101 1e-19 gb|EXC35005.1| UDP-arabinose 4-epimerase 1 [Morus notabilis] 100 4e-19 ref|XP_002270765.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Viti... 98 1e-18 gb|EYU43159.1| hypothetical protein MIMGU_mgv1a007922mg [Mimulus... 97 3e-18 ref|XP_006305097.1| hypothetical protein CARUB_v10009466mg [Caps... 97 3e-18 ref|XP_002890883.1| hypothetical protein ARALYDRAFT_890616 [Arab... 97 3e-18 ref|XP_006351986.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 96 4e-18 ref|XP_004504171.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 96 4e-18 ref|XP_004252048.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 96 4e-18 ref|XP_006415442.1| hypothetical protein EUTSA_v10007740mg [Eutr... 96 7e-18 ref|NP_174350.2| UDP-arabinose 4-epimerase 1 [Arabidopsis thalia... 96 7e-18 ref|NP_001077632.1| UDP-arabinose 4-epimerase 1 [Arabidopsis tha... 96 7e-18 dbj|BAD94059.1| UDP-galactose 4-epimerase-like protein [Arabidop... 96 7e-18 gb|AAN60309.1| unknown [Arabidopsis thaliana] 96 7e-18 ref|XP_003533104.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 95 9e-18 ref|NP_001169245.1| hypothetical protein [Zea mays] gi|223975761... 95 9e-18 ref|XP_007211748.1| hypothetical protein PRUPE_ppa006315mg [Prun... 95 1e-17 ref|XP_004293701.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 94 1e-17 >ref|XP_002264946.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Vitis vinifera] gi|296087462|emb|CBI34051.3| unnamed protein product [Vitis vinifera] Length = 417 Score = 103 bits (257), Expect = 2e-20 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -3 Query: 426 IKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 IKVEYL RRPGDYAEVYSDPSKIL EL W A+YTNL+ESL TAWRWQK+HRNGY Sbjct: 356 IKVEYLDRRPGDYAEVYSDPSKILRELNWTAQYTNLQESLQTAWRWQKSHRNGY 409 >gb|EPS59190.1| hypothetical protein M569_15620, partial [Genlisea aurea] Length = 243 Score = 101 bits (252), Expect = 9e-20 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -3 Query: 426 IKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 IKVEYLSRRPGDYAEVYSDPSKI +EL W AK+T+L+ SL+TAWRWQKAHRNGY Sbjct: 190 IKVEYLSRRPGDYAEVYSDPSKIRNELNWTAKFTDLQHSLSTAWRWQKAHRNGY 243 >gb|EYU42844.1| hypothetical protein MIMGU_mgv1a007948mg [Mimulus guttatus] Length = 390 Score = 101 bits (251), Expect = 1e-19 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = -3 Query: 426 IKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGYE 262 IKV+YL RR GDYAEVYSDPSKI +EL W+AKYTNL+ESLA AWRWQKAH NGYE Sbjct: 335 IKVDYLDRRAGDYAEVYSDPSKIFNELNWKAKYTNLQESLAVAWRWQKAHINGYE 389 >gb|EXC35005.1| UDP-arabinose 4-epimerase 1 [Morus notabilis] Length = 363 Score = 99.8 bits (247), Expect = 4e-19 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = -3 Query: 426 IKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 IKVEYL RRPGDYAEVYSDPSKI+ ELGW A+YT+L+ESLA AWRWQK+H NGY Sbjct: 302 IKVEYLDRRPGDYAEVYSDPSKIMWELGWTARYTDLQESLAIAWRWQKSHLNGY 355 >ref|XP_002270765.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Vitis vinifera] gi|297740899|emb|CBI31081.3| unnamed protein product [Vitis vinifera] Length = 418 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = -3 Query: 426 IKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 IKVEYL+RRPGDYAEV+SDPSKI EL W AKYT+L+ESL AWRWQKAHRNGY Sbjct: 356 IKVEYLARRPGDYAEVFSDPSKIDHELNWTAKYTDLQESLRVAWRWQKAHRNGY 409 >gb|EYU43159.1| hypothetical protein MIMGU_mgv1a007922mg [Mimulus guttatus] Length = 391 Score = 96.7 bits (239), Expect = 3e-18 Identities = 44/55 (80%), Positives = 47/55 (85%) Frame = -3 Query: 426 IKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGYE 262 IKVEYLSRR GDYAEVYSDPSKI EL W A YTNL++SL TAW+WQKAH NGYE Sbjct: 336 IKVEYLSRRAGDYAEVYSDPSKINIELNWTATYTNLQQSLTTAWKWQKAHLNGYE 390 >ref|XP_006305097.1| hypothetical protein CARUB_v10009466mg [Capsella rubella] gi|565494918|ref|XP_006305098.1| hypothetical protein CARUB_v10009466mg [Capsella rubella] gi|565494920|ref|XP_006305099.1| hypothetical protein CARUB_v10009466mg [Capsella rubella] gi|482573808|gb|EOA37995.1| hypothetical protein CARUB_v10009466mg [Capsella rubella] gi|482573809|gb|EOA37996.1| hypothetical protein CARUB_v10009466mg [Capsella rubella] gi|482573810|gb|EOA37997.1| hypothetical protein CARUB_v10009466mg [Capsella rubella] Length = 376 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/55 (78%), Positives = 47/55 (85%) Frame = -3 Query: 429 KIKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 +IK+EYL RR GDYAEVYSDPSKI EL W AK+TNL+ESL TAWRWQK HRNGY Sbjct: 313 EIKIEYLPRRAGDYAEVYSDPSKIKKELNWTAKHTNLKESLETAWRWQKLHRNGY 367 >ref|XP_002890883.1| hypothetical protein ARALYDRAFT_890616 [Arabidopsis lyrata subsp. lyrata] gi|297336725|gb|EFH67142.1| hypothetical protein ARALYDRAFT_890616 [Arabidopsis lyrata subsp. lyrata] Length = 418 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/55 (78%), Positives = 47/55 (85%) Frame = -3 Query: 429 KIKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 +IK+EYL RR GDYAEVYSDPSKI EL W AK+TNL+ESL TAWRWQK HRNGY Sbjct: 355 EIKIEYLPRRAGDYAEVYSDPSKIRKELNWTAKHTNLKESLETAWRWQKLHRNGY 409 >ref|XP_006351986.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Solanum tuberosum] Length = 389 Score = 96.3 bits (238), Expect = 4e-18 Identities = 46/54 (85%), Positives = 48/54 (88%) Frame = -3 Query: 426 IKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 IKVEYL+RRPGDYAEVYSDPSKI EL W A+YT LEESLA AWRWQKAHRNGY Sbjct: 336 IKVEYLTRRPGDYAEVYSDPSKIRHELNWIARYT-LEESLAIAWRWQKAHRNGY 388 >ref|XP_004504171.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X1 [Cicer arietinum] gi|502140334|ref|XP_004504172.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X2 [Cicer arietinum] gi|502140336|ref|XP_004504173.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X3 [Cicer arietinum] gi|502140338|ref|XP_004504174.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X4 [Cicer arietinum] gi|502140340|ref|XP_004504175.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X5 [Cicer arietinum] Length = 416 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -3 Query: 426 IKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 IKVEYL+RRPGDYAEVYSDP+KI EL W A+ TNLEESL TAWRWQK+HR+GY Sbjct: 356 IKVEYLARRPGDYAEVYSDPTKINQELNWSAQRTNLEESLRTAWRWQKSHRDGY 409 >ref|XP_004252048.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Solanum lycopersicum] Length = 393 Score = 96.3 bits (238), Expect = 4e-18 Identities = 46/54 (85%), Positives = 48/54 (88%) Frame = -3 Query: 426 IKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 IKVEYL+RRPGDYAEVYSDPSKI EL W A+YT LEESLA AWRWQKAHRNGY Sbjct: 340 IKVEYLTRRPGDYAEVYSDPSKIRHELNWIARYT-LEESLAIAWRWQKAHRNGY 392 >ref|XP_006415442.1| hypothetical protein EUTSA_v10007740mg [Eutrema salsugineum] gi|567146170|ref|XP_006415443.1| hypothetical protein EUTSA_v10007740mg [Eutrema salsugineum] gi|567146174|ref|XP_006415444.1| hypothetical protein EUTSA_v10007740mg [Eutrema salsugineum] gi|567146178|ref|XP_006415445.1| hypothetical protein EUTSA_v10007740mg [Eutrema salsugineum] gi|557093213|gb|ESQ33795.1| hypothetical protein EUTSA_v10007740mg [Eutrema salsugineum] gi|557093214|gb|ESQ33796.1| hypothetical protein EUTSA_v10007740mg [Eutrema salsugineum] gi|557093215|gb|ESQ33797.1| hypothetical protein EUTSA_v10007740mg [Eutrema salsugineum] gi|557093216|gb|ESQ33798.1| hypothetical protein EUTSA_v10007740mg [Eutrema salsugineum] Length = 418 Score = 95.5 bits (236), Expect = 7e-18 Identities = 42/55 (76%), Positives = 47/55 (85%) Frame = -3 Query: 429 KIKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 +IK++YL RR GDYAEVYSDPSKI EL W AK+TNL+ESL TAWRWQK HRNGY Sbjct: 355 EIKIDYLPRRAGDYAEVYSDPSKIRKELNWTAKHTNLKESLETAWRWQKLHRNGY 409 >ref|NP_174350.2| UDP-arabinose 4-epimerase 1 [Arabidopsis thaliana] gi|79318985|ref|NP_001031118.1| UDP-arabinose 4-epimerase 1 [Arabidopsis thaliana] gi|75313130|sp|Q9SA77.1|ARAE1_ARATH RecName: Full=UDP-arabinose 4-epimerase 1; AltName: Full=UDP-D-xylose 4-epimerase 1 gi|4587518|gb|AAD25749.1|AC007060_7 Strong similarity to F19I3.8 gi|3033381 putative UDP-galactose-4-epimerase from Arabidopsis thaliana BAC gb|AC004238 and is a member of PF|01370 the NAD dependent epimerase/dehydratase family. EST gb|AA597338 comes from this gene [Arabidopsis thaliana] gi|13272475|gb|AAK17176.1|AF325108_1 unknown protein [Arabidopsis thaliana] gi|18086329|gb|AAL57628.1| At1g30620/T5I8_7 [Arabidopsis thaliana] gi|27363222|gb|AAO11530.1| At1g30620/T5I8_7 [Arabidopsis thaliana] gi|28395529|gb|AAO39213.1| UDP-D-xylose 4-epimerase [Arabidopsis thaliana] gi|222423784|dbj|BAH19858.1| AT1G30620 [Arabidopsis thaliana] gi|332193130|gb|AEE31251.1| UDP-arabinose 4-epimerase [Arabidopsis thaliana] gi|332193131|gb|AEE31252.1| UDP-arabinose 4-epimerase [Arabidopsis thaliana] Length = 419 Score = 95.5 bits (236), Expect = 7e-18 Identities = 42/55 (76%), Positives = 47/55 (85%) Frame = -3 Query: 429 KIKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 +IK++YL RR GDYAEVYSDPSKI EL W AK+TNL+ESL TAWRWQK HRNGY Sbjct: 355 EIKIDYLPRRAGDYAEVYSDPSKIRKELNWTAKHTNLKESLETAWRWQKLHRNGY 409 >ref|NP_001077632.1| UDP-arabinose 4-epimerase 1 [Arabidopsis thaliana] gi|332193132|gb|AEE31253.1| UDP-arabinose 4-epimerase [Arabidopsis thaliana] Length = 418 Score = 95.5 bits (236), Expect = 7e-18 Identities = 42/55 (76%), Positives = 47/55 (85%) Frame = -3 Query: 429 KIKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 +IK++YL RR GDYAEVYSDPSKI EL W AK+TNL+ESL TAWRWQK HRNGY Sbjct: 354 EIKIDYLPRRAGDYAEVYSDPSKIRKELNWTAKHTNLKESLETAWRWQKLHRNGY 408 >dbj|BAD94059.1| UDP-galactose 4-epimerase-like protein [Arabidopsis thaliana] Length = 237 Score = 95.5 bits (236), Expect = 7e-18 Identities = 42/55 (76%), Positives = 47/55 (85%) Frame = -3 Query: 429 KIKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 +IK++YL RR GDYAEVYSDPSKI EL W AK+TNL+ESL TAWRWQK HRNGY Sbjct: 173 EIKIDYLPRRAGDYAEVYSDPSKIRKELNWTAKHTNLKESLETAWRWQKLHRNGY 227 >gb|AAN60309.1| unknown [Arabidopsis thaliana] Length = 419 Score = 95.5 bits (236), Expect = 7e-18 Identities = 42/55 (76%), Positives = 47/55 (85%) Frame = -3 Query: 429 KIKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 +IK++YL RR GDYAEVYSDPSKI EL W AK+TNL+ESL TAWRWQK HRNGY Sbjct: 355 EIKIDYLPRRAGDYAEVYSDPSKIRKELNWTAKHTNLKESLETAWRWQKLHRNGY 409 >ref|XP_003533104.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Glycine max] Length = 415 Score = 95.1 bits (235), Expect = 9e-18 Identities = 42/54 (77%), Positives = 47/54 (87%) Frame = -3 Query: 426 IKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 IKV+YL RRPGDYAEVYSDPSKI EL W A+YT+LE+SL AW+WQKAHRNGY Sbjct: 356 IKVDYLPRRPGDYAEVYSDPSKINRELNWTAQYTDLEKSLQVAWKWQKAHRNGY 409 >ref|NP_001169245.1| hypothetical protein [Zea mays] gi|223975761|gb|ACN32068.1| unknown [Zea mays] gi|413919533|gb|AFW59465.1| hypothetical protein ZEAMMB73_490689 [Zea mays] Length = 415 Score = 95.1 bits (235), Expect = 9e-18 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = -3 Query: 426 IKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 IKVEYL+RRPGDYAEVYSDPSKIL +L W A+YT+L +SLA AW+WQKAH NGY Sbjct: 359 IKVEYLARRPGDYAEVYSDPSKILRDLNWTAQYTDLGQSLAQAWKWQKAHPNGY 412 >ref|XP_007211748.1| hypothetical protein PRUPE_ppa006315mg [Prunus persica] gi|462407613|gb|EMJ12947.1| hypothetical protein PRUPE_ppa006315mg [Prunus persica] gi|464895971|gb|AGH25534.1| UDP-D-xylose 4-epimerase [Prunus persica] Length = 417 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -3 Query: 426 IKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 IKV++L RRPGDYAEVYSDPSKIL EL W A++TNL+ESL AWRWQK+HR+GY Sbjct: 356 IKVDFLPRRPGDYAEVYSDPSKILRELNWTAQHTNLQESLQVAWRWQKSHRDGY 409 >ref|XP_004293701.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Fragaria vesca subsp. vesca] Length = 418 Score = 94.4 bits (233), Expect = 1e-17 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = -3 Query: 426 IKVEYLSRRPGDYAEVYSDPSKILSELGWRAKYTNLEESLATAWRWQKAHRNGY 265 IKV+YL RRPGDYAEVYSDPSKIL EL W A++ NL+ESL AWRWQK+HR+GY Sbjct: 356 IKVDYLPRRPGDYAEVYSDPSKILRELNWTAQHANLQESLQVAWRWQKSHRDGY 409