BLASTX nr result
ID: Mentha26_contig00044048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00044048 (386 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006482328.1| PREDICTED: ATP-dependent zinc metalloproteas... 60 2e-07 gb|EYU44272.1| hypothetical protein MIMGU_mgv1a006519mg [Mimulus... 59 5e-07 ref|XP_006430865.1| hypothetical protein CICLE_v10011254mg [Citr... 59 9e-07 >ref|XP_006482328.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like [Citrus sinensis] Length = 653 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/43 (69%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -2 Query: 385 RQRNPNTLSKALVKLFPWMPSFTNRNDTRRDG-QG-LGYQTLS 263 RQ+ PNT+SK L KLFPWMPS RNDT++DG QG +GYQTLS Sbjct: 611 RQQRPNTISKELGKLFPWMPSLMGRNDTKQDGLQGPMGYQTLS 653 >gb|EYU44272.1| hypothetical protein MIMGU_mgv1a006519mg [Mimulus guttatus] Length = 441 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -2 Query: 385 RQRNPNTLSKALVKLFPWMPSFTNRNDTRRDGQ-GLGYQTLS 263 RQ + T+SK LVKLFPWMPS TNRN++R+D Q LGYQTLS Sbjct: 400 RQTSATTISKELVKLFPWMPSLTNRNNSRKDPQPPLGYQTLS 441 >ref|XP_006430865.1| hypothetical protein CICLE_v10011254mg [Citrus clementina] gi|557532922|gb|ESR44105.1| hypothetical protein CICLE_v10011254mg [Citrus clementina] Length = 653 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -2 Query: 385 RQRNPNTLSKALVKLFPWMPSFTNRNDTRRDG-QG-LGYQTLS 263 RQ+ P+T+SK L KLFPWMPS RNDT++DG QG +GYQTLS Sbjct: 611 RQQRPSTISKELGKLFPWMPSLMGRNDTKQDGLQGPMGYQTLS 653