BLASTX nr result
ID: Mentha26_contig00044042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00044042 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34416.1| hypothetical protein MIMGU_mgv1a007896mg [Mimulus... 62 1e-07 >gb|EYU34416.1| hypothetical protein MIMGU_mgv1a007896mg [Mimulus guttatus] Length = 392 Score = 61.6 bits (148), Expect = 1e-07 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 3/69 (4%) Frame = -1 Query: 214 FTFHSSVKPKIGDDETVVRSGLYCDEGGEEECGRKTKFET--PRPISGDALGALLEQKLK 41 F F+SS K + G+ E VRS LY D+G R+ K E P P+SGDALGA+LEQKLK Sbjct: 14 FKFNSSAKQRSGNAERKVRSNLYFDDG------RRAKLENAAPPPLSGDALGAILEQKLK 67 Query: 40 EL-NCQGED 17 EL N Q ED Sbjct: 68 ELNNVQRED 76