BLASTX nr result
ID: Mentha26_contig00043980
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043980 (542 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46649.1| hypothetical protein MIMGU_mgv1a004791mg [Mimulus... 77 3e-12 >gb|EYU46649.1| hypothetical protein MIMGU_mgv1a004791mg [Mimulus guttatus] Length = 510 Score = 77.0 bits (188), Expect = 3e-12 Identities = 41/64 (64%), Positives = 47/64 (73%) Frame = -3 Query: 528 DRAFPPHNSREQSVFNQRSYSLNASSEPSELSRGRVYLHREADVTSAPVSHRYSFAGPSL 349 DRA REQS FNQR YSL+AS EPS L +G ++ RE ++TSAPVS RYSFAGPS Sbjct: 448 DRAVGSRTLREQSTFNQRPYSLDASREPSVLHQG-FHIQREIELTSAPVSSRYSFAGPSP 506 Query: 348 SQHR 337 SQHR Sbjct: 507 SQHR 510