BLASTX nr result
ID: Mentha26_contig00043865
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043865 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41644.1| hypothetical protein MIMGU_mgv1a001284mg [Mimulus... 78 1e-12 ref|XP_006367266.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_004246707.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 ref|XP_007208081.1| hypothetical protein PRUPE_ppa001520mg [Prun... 58 2e-06 >gb|EYU41644.1| hypothetical protein MIMGU_mgv1a001284mg [Mimulus guttatus] Length = 847 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/63 (61%), Positives = 50/63 (79%) Frame = +2 Query: 131 ISEDGRFEEFLMIAESVVASGVKMSEFLALLKSEHLVSGIVRVLRDGKPSSVVDMLFNGI 310 ++EDG FE+FLMI+ESVVASGVK SEFLALL ++ + G+ RVL +G SVV MLFNG+ Sbjct: 80 LAEDGMFEDFLMISESVVASGVKPSEFLALLNAKCVAIGVARVLDEGNLHSVVKMLFNGL 139 Query: 311 RKL 319 K+ Sbjct: 140 EKI 142 >ref|XP_006367266.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Solanum tuberosum] Length = 859 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/63 (52%), Positives = 47/63 (74%) Frame = +2 Query: 131 ISEDGRFEEFLMIAESVVASGVKMSEFLALLKSEHLVSGIVRVLRDGKPSSVVDMLFNGI 310 +++DGRF++ LMIAESVV SGV +EF ALL + + GIVR+L + K SVV++L NG Sbjct: 85 LAQDGRFDDSLMIAESVVVSGVNAAEFAALLNVKLVSGGIVRLLEERKVGSVVELL-NGA 143 Query: 311 RKL 319 ++L Sbjct: 144 QQL 146 >ref|XP_004246707.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Solanum lycopersicum] Length = 857 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/63 (52%), Positives = 46/63 (73%) Frame = +2 Query: 131 ISEDGRFEEFLMIAESVVASGVKMSEFLALLKSEHLVSGIVRVLRDGKPSSVVDMLFNGI 310 +++DGRF++ LMIAESVV SGV EF ALL + + GIVR+L + K SVV++L NG Sbjct: 87 LAQDGRFDDSLMIAESVVVSGVNAEEFTALLNVKLVSGGIVRLLEERKVGSVVELL-NGA 145 Query: 311 RKL 319 ++L Sbjct: 146 QQL 148 >ref|XP_007208081.1| hypothetical protein PRUPE_ppa001520mg [Prunus persica] gi|462403723|gb|EMJ09280.1| hypothetical protein PRUPE_ppa001520mg [Prunus persica] Length = 809 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/56 (50%), Positives = 41/56 (73%) Frame = +2 Query: 131 ISEDGRFEEFLMIAESVVASGVKMSEFLALLKSEHLVSGIVRVLRDGKPSSVVDML 298 ++ DG+F++F M+ ESVV SGV+ SEF A LK E + GI +L++GK SVV++L Sbjct: 84 LARDGKFQDFAMVVESVVLSGVRGSEFTAALKLELVAKGISGLLKEGKVRSVVEVL 139