BLASTX nr result
ID: Mentha26_contig00043840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043840 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34737.1| hypothetical protein MIMGU_mgv1a002326mg [Mimulus... 123 3e-26 ref|XP_002274196.2| PREDICTED: glycosylphosphatidylinositol anch... 113 3e-23 emb|CBI34867.3| unnamed protein product [Vitis vinifera] 113 3e-23 ref|XP_004156691.1| PREDICTED: glycosylphosphatidylinositol anch... 108 8e-22 ref|XP_004233324.1| PREDICTED: glycosylphosphatidylinositol anch... 107 1e-21 ref|XP_007214987.1| hypothetical protein PRUPE_ppa002024mg [Prun... 107 2e-21 ref|XP_004142789.1| PREDICTED: LOW QUALITY PROTEIN: glycosylphos... 107 2e-21 ref|XP_002300056.1| GPI transamidase component family protein [P... 106 4e-21 ref|XP_006357159.1| PREDICTED: glycosylphosphatidylinositol anch... 105 7e-21 ref|XP_006357158.1| PREDICTED: glycosylphosphatidylinositol anch... 105 7e-21 ref|XP_006470242.1| PREDICTED: glycosylphosphatidylinositol anch... 103 3e-20 ref|XP_007031574.1| GPI transamidase component family protein / ... 102 7e-20 ref|XP_006446587.1| hypothetical protein CICLE_v10014455mg [Citr... 101 9e-20 ref|XP_006446586.1| hypothetical protein CICLE_v10014455mg [Citr... 101 9e-20 ref|XP_004306361.1| PREDICTED: glycosylphosphatidylinositol anch... 101 1e-19 ref|XP_003554817.1| PREDICTED: glycosylphosphatidylinositol anch... 100 3e-19 ref|XP_006579784.1| PREDICTED: glycosylphosphatidylinositol anch... 100 4e-19 ref|XP_007150932.1| hypothetical protein PHAVU_004G006900g [Phas... 99 5e-19 ref|XP_004489231.1| PREDICTED: glycosylphosphatidylinositol anch... 99 5e-19 ref|XP_004489230.1| PREDICTED: glycosylphosphatidylinositol anch... 99 5e-19 >gb|EYU34737.1| hypothetical protein MIMGU_mgv1a002326mg [Mimulus guttatus] Length = 688 Score = 123 bits (308), Expect = 3e-26 Identities = 53/71 (74%), Positives = 59/71 (83%) Frame = +3 Query: 3 ACNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCW 182 ACN+LLVF+GFPPI FLLLKG L+ F + +FWNW ESL AWNSATYIY+CMVHLPCW Sbjct: 618 ACNVLLVFLGFPPIIFLLLKGALDGFSSVGFGDFWNWAESLWAWNSATYIYMCMVHLPCW 677 Query: 183 VLCILILLHRC 215 VLCI LLHRC Sbjct: 678 VLCIRTLLHRC 688 >ref|XP_002274196.2| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein [Vitis vinifera] Length = 701 Score = 113 bits (282), Expect = 3e-23 Identities = 47/70 (67%), Positives = 55/70 (78%) Frame = +3 Query: 6 CNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCWV 185 CNL+L F+GFPP AF +LKG FE + + +FWNW+ESL AWNSATY+YI MVHLPCW Sbjct: 632 CNLVLGFIGFPPAAFFVLKGSFEGFESVNISDFWNWIESLWAWNSATYLYIGMVHLPCWA 691 Query: 186 LCILILLHRC 215 LCI ILLH C Sbjct: 692 LCIWILLHPC 701 >emb|CBI34867.3| unnamed protein product [Vitis vinifera] Length = 690 Score = 113 bits (282), Expect = 3e-23 Identities = 47/70 (67%), Positives = 55/70 (78%) Frame = +3 Query: 6 CNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCWV 185 CNL+L F+GFPP AF +LKG FE + + +FWNW+ESL AWNSATY+YI MVHLPCW Sbjct: 621 CNLVLGFIGFPPAAFFVLKGSFEGFESVNISDFWNWIESLWAWNSATYLYIGMVHLPCWA 680 Query: 186 LCILILLHRC 215 LCI ILLH C Sbjct: 681 LCIWILLHPC 690 >ref|XP_004156691.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like [Cucumis sativus] Length = 714 Score = 108 bits (270), Expect = 8e-22 Identities = 43/71 (60%), Positives = 55/71 (77%) Frame = +3 Query: 3 ACNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCW 182 ACNL+L F+ FPP+ F L KG L F+ + + +FWNWME+L AWNSAT++Y+ MVHLPCW Sbjct: 644 ACNLVLGFIAFPPVTFFLFKGALQGFDNLHIGDFWNWMETLWAWNSATFLYLGMVHLPCW 703 Query: 183 VLCILILLHRC 215 +LC ILLH C Sbjct: 704 LLCTQILLHPC 714 >ref|XP_004233324.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like [Solanum lycopersicum] Length = 707 Score = 107 bits (268), Expect = 1e-21 Identities = 44/71 (61%), Positives = 56/71 (78%) Frame = +3 Query: 3 ACNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCW 182 ACN++L+F+ FPP+A+ L KG L E R+ +FWNW+ESL WNSATYIY+CMVHLPCW Sbjct: 637 ACNIVLIFLVFPPVAYYLWKGALVGVENARVGDFWNWVESLWTWNSATYIYMCMVHLPCW 696 Query: 183 VLCILILLHRC 215 VLC+ LL+ C Sbjct: 697 VLCVHTLLYPC 707 >ref|XP_007214987.1| hypothetical protein PRUPE_ppa002024mg [Prunus persica] gi|462411137|gb|EMJ16186.1| hypothetical protein PRUPE_ppa002024mg [Prunus persica] Length = 727 Score = 107 bits (267), Expect = 2e-21 Identities = 45/69 (65%), Positives = 56/69 (81%) Frame = +3 Query: 9 NLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCWVL 188 NL+L F+GFPPIAF++LKG F + + +FW+W+ESL AWNSATY+YI MV+LPCWVL Sbjct: 659 NLVLGFIGFPPIAFIVLKGAFEGFSGVNVGDFWSWVESLWAWNSATYLYIGMVYLPCWVL 718 Query: 189 CILILLHRC 215 CI IL HRC Sbjct: 719 CIHILFHRC 727 >ref|XP_004142789.1| PREDICTED: LOW QUALITY PROTEIN: glycosylphosphatidylinositol anchor attachment 1 protein-like [Cucumis sativus] Length = 714 Score = 107 bits (266), Expect = 2e-21 Identities = 42/71 (59%), Positives = 54/71 (76%) Frame = +3 Query: 3 ACNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCW 182 ACNL+L F+ FPP+ F L KG L F+ + + +FWNWME+L AWNSAT++Y+ MVHLPCW Sbjct: 644 ACNLVLGFIAFPPVTFFLFKGALQGFDNLHIGDFWNWMETLWAWNSATFLYLGMVHLPCW 703 Query: 183 VLCILILLHRC 215 +C ILLH C Sbjct: 704 XICTQILLHPC 714 >ref|XP_002300056.1| GPI transamidase component family protein [Populus trichocarpa] gi|222847314|gb|EEE84861.1| GPI transamidase component family protein [Populus trichocarpa] Length = 716 Score = 106 bits (264), Expect = 4e-21 Identities = 46/70 (65%), Positives = 54/70 (77%) Frame = +3 Query: 6 CNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCWV 185 CN++L FV FPP AF ++K F+ I + +FWNWMESL AWNSATYIYI MVHLPCWV Sbjct: 647 CNVVLGFVAFPPAAFFVVKTIFEGFDSINMGDFWNWMESLWAWNSATYIYIGMVHLPCWV 706 Query: 186 LCILILLHRC 215 LC+ ILLH C Sbjct: 707 LCLHILLHSC 716 >ref|XP_006357159.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like isoform X2 [Solanum tuberosum] Length = 659 Score = 105 bits (262), Expect = 7e-21 Identities = 42/71 (59%), Positives = 56/71 (78%) Frame = +3 Query: 3 ACNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCW 182 ACN++L+F+ FPP+A+ L KG L + R+ +FWNW+ESL WNSATYIY+CMVHLPCW Sbjct: 589 ACNVVLIFLVFPPVAYYLWKGALVGLDNARVGDFWNWVESLWTWNSATYIYMCMVHLPCW 648 Query: 183 VLCILILLHRC 215 VLC+ L++ C Sbjct: 649 VLCVHTLVYPC 659 >ref|XP_006357158.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like isoform X1 [Solanum tuberosum] Length = 704 Score = 105 bits (262), Expect = 7e-21 Identities = 42/71 (59%), Positives = 56/71 (78%) Frame = +3 Query: 3 ACNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCW 182 ACN++L+F+ FPP+A+ L KG L + R+ +FWNW+ESL WNSATYIY+CMVHLPCW Sbjct: 634 ACNVVLIFLVFPPVAYYLWKGALVGLDNARVGDFWNWVESLWTWNSATYIYMCMVHLPCW 693 Query: 183 VLCILILLHRC 215 VLC+ L++ C Sbjct: 694 VLCVHTLVYPC 704 >ref|XP_006470242.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like [Citrus sinensis] Length = 699 Score = 103 bits (256), Expect = 3e-20 Identities = 43/70 (61%), Positives = 52/70 (74%) Frame = +3 Query: 6 CNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCWV 185 CNL+L + FPP F + KG + F I+ +FWNW+ESL AWNSATY+YI MVHLPCWV Sbjct: 630 CNLVLGVISFPPATFFVFKGVIEGFSGIKAGDFWNWVESLWAWNSATYLYIGMVHLPCWV 689 Query: 186 LCILILLHRC 215 LC+ ILLH C Sbjct: 690 LCVQILLHPC 699 >ref|XP_007031574.1| GPI transamidase component family protein / Gaa1-like family protein [Theobroma cacao] gi|508710603|gb|EOY02500.1| GPI transamidase component family protein / Gaa1-like family protein [Theobroma cacao] Length = 717 Score = 102 bits (253), Expect = 7e-20 Identities = 44/70 (62%), Positives = 53/70 (75%) Frame = +3 Query: 6 CNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCWV 185 CNL+L + FPP AF LLKG L F + + +FW W+ESL AWNSATYI+I MV+LPCWV Sbjct: 648 CNLVLGLIAFPPAAFFLLKGMLEDFGSVNIGDFWMWVESLWAWNSATYIFIGMVYLPCWV 707 Query: 186 LCILILLHRC 215 LC+ ILLH C Sbjct: 708 LCVHILLHTC 717 >ref|XP_006446587.1| hypothetical protein CICLE_v10014455mg [Citrus clementina] gi|557549198|gb|ESR59827.1| hypothetical protein CICLE_v10014455mg [Citrus clementina] Length = 699 Score = 101 bits (252), Expect = 9e-20 Identities = 43/70 (61%), Positives = 51/70 (72%) Frame = +3 Query: 6 CNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCWV 185 CNL+L + FPP F + KG + F I +FWNW+ESL AWNSATY+YI MVHLPCWV Sbjct: 630 CNLVLGVITFPPATFFVFKGVIEGFSGINAGDFWNWVESLWAWNSATYLYIGMVHLPCWV 689 Query: 186 LCILILLHRC 215 LC+ ILLH C Sbjct: 690 LCVQILLHPC 699 >ref|XP_006446586.1| hypothetical protein CICLE_v10014455mg [Citrus clementina] gi|557549197|gb|ESR59826.1| hypothetical protein CICLE_v10014455mg [Citrus clementina] Length = 597 Score = 101 bits (252), Expect = 9e-20 Identities = 43/70 (61%), Positives = 51/70 (72%) Frame = +3 Query: 6 CNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCWV 185 CNL+L + FPP F + KG + F I +FWNW+ESL AWNSATY+YI MVHLPCWV Sbjct: 528 CNLVLGVITFPPATFFVFKGVIEGFSGINAGDFWNWVESLWAWNSATYLYIGMVHLPCWV 587 Query: 186 LCILILLHRC 215 LC+ ILLH C Sbjct: 588 LCVQILLHPC 597 >ref|XP_004306361.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like [Fragaria vesca subsp. vesca] Length = 741 Score = 101 bits (251), Expect = 1e-19 Identities = 42/71 (59%), Positives = 53/71 (74%) Frame = +3 Query: 3 ACNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCW 182 ACNL+L VGFPP+ F++LKG F + + +FW+W+ESL WNSATY+YI +VHLP W Sbjct: 671 ACNLVLGIVGFPPVTFIVLKGAFEGFGSVSVGDFWSWVESLWVWNSATYLYIGVVHLPSW 730 Query: 183 VLCILILLHRC 215 VLCI IL H C Sbjct: 731 VLCIHILFHNC 741 >ref|XP_003554817.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like [Glycine max] Length = 707 Score = 100 bits (248), Expect = 3e-19 Identities = 40/71 (56%), Positives = 52/71 (73%) Frame = +3 Query: 3 ACNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCW 182 +CN+ L F+ FPP+AF+LLKG F + ++WNW+ESL WNSATY+Y+ +VHLPCW Sbjct: 637 SCNIALGFIVFPPVAFVLLKGAFEDFYGMNFGDYWNWVESLWVWNSATYLYVGVVHLPCW 696 Query: 183 VLCILILLHRC 215 LCI IL H C Sbjct: 697 ALCIHILFHPC 707 >ref|XP_006579784.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like isoform X1 [Glycine max] gi|571454422|ref|XP_006579785.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like isoform X2 [Glycine max] Length = 707 Score = 99.8 bits (247), Expect = 4e-19 Identities = 39/71 (54%), Positives = 52/71 (73%) Frame = +3 Query: 3 ACNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCW 182 +CN+ L F+ FPP+AF+LLKG F + ++WNW+ESL WNSATY+Y+ ++HLPCW Sbjct: 637 SCNIALGFIVFPPVAFVLLKGAFEDFYGMNFGDYWNWVESLWVWNSATYLYVGVIHLPCW 696 Query: 183 VLCILILLHRC 215 LCI IL H C Sbjct: 697 ALCIHILFHPC 707 >ref|XP_007150932.1| hypothetical protein PHAVU_004G006900g [Phaseolus vulgaris] gi|561024241|gb|ESW22926.1| hypothetical protein PHAVU_004G006900g [Phaseolus vulgaris] Length = 707 Score = 99.4 bits (246), Expect = 5e-19 Identities = 42/71 (59%), Positives = 53/71 (74%) Frame = +3 Query: 3 ACNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCW 182 +CN+ L FV FPP+AF+LLKG F I + ++WNW+ESL AWNSATY+Y+ +VHLP W Sbjct: 637 SCNIALGFVLFPPVAFVLLKGAFEDFYGINVGDYWNWVESLWAWNSATYLYVGVVHLPSW 696 Query: 183 VLCILILLHRC 215 LCI IL H C Sbjct: 697 ALCIHILFHPC 707 >ref|XP_004489231.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like isoform X3 [Cicer arietinum] Length = 634 Score = 99.4 bits (246), Expect = 5e-19 Identities = 39/70 (55%), Positives = 51/70 (72%) Frame = +3 Query: 6 CNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCWV 185 CNL L F+ FPP+A++L+KG F + ++WNW+ESL WNSATY+Y+ +VHLPCW Sbjct: 565 CNLALGFIAFPPVAYVLMKGAFEDFYGTSVGDYWNWVESLWTWNSATYLYVGIVHLPCWA 624 Query: 186 LCILILLHRC 215 LCI IL H C Sbjct: 625 LCIHILFHSC 634 >ref|XP_004489230.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like isoform X2 [Cicer arietinum] Length = 698 Score = 99.4 bits (246), Expect = 5e-19 Identities = 39/70 (55%), Positives = 51/70 (72%) Frame = +3 Query: 6 CNLLLVFVGFPPIAFLLLKGGLNSFERIRLVEFWNWMESLRAWNSATYIYICMVHLPCWV 185 CNL L F+ FPP+A++L+KG F + ++WNW+ESL WNSATY+Y+ +VHLPCW Sbjct: 629 CNLALGFIAFPPVAYVLMKGAFEDFYGTSVGDYWNWVESLWTWNSATYLYVGIVHLPCWA 688 Query: 186 LCILILLHRC 215 LCI IL H C Sbjct: 689 LCIHILFHSC 698