BLASTX nr result
ID: Mentha26_contig00043837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043837 (421 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17669.1| hypothetical protein MIMGU_mgv1a015403mg [Mimulus... 55 8e-06 >gb|EYU17669.1| hypothetical protein MIMGU_mgv1a015403mg [Mimulus guttatus] Length = 157 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +3 Query: 6 QKVTRHEMIQRVRHIAGDKLLMTIIKSYRSKMKSPRNGG 122 +K+TR E+IQ VR++AGDKLLM IIKSYR K+K P + G Sbjct: 115 RKITRQELIQLVRNVAGDKLLMAIIKSYRRKIKQPSSNG 153