BLASTX nr result
ID: Mentha26_contig00043835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043835 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004297467.1| PREDICTED: cysteine-rich receptor-like prote... 65 7e-09 ref|XP_004236943.1| PREDICTED: cysteine-rich receptor-like prote... 65 1e-08 ref|XP_004236942.1| PREDICTED: cysteine-rich receptor-like prote... 65 1e-08 ref|XP_004142276.1| PREDICTED: cysteine-rich receptor-like prote... 65 1e-08 ref|XP_006355074.1| PREDICTED: cysteine-rich receptor-like prote... 64 2e-08 gb|EPS59620.1| hypothetical protein M569_15182 [Genlisea aurea] 64 2e-08 ref|XP_006469213.1| PREDICTED: cysteine-rich receptor-like prote... 64 2e-08 ref|XP_006448211.1| hypothetical protein CICLE_v10015463mg [Citr... 64 2e-08 gb|EYU33124.1| hypothetical protein MIMGU_mgv1a007864mg [Mimulus... 63 5e-08 ref|XP_007045211.1| Cysteine-rich receptor-like protein kinase 1... 63 5e-08 ref|XP_002315871.2| kinase family protein [Populus trichocarpa] ... 62 6e-08 ref|XP_002527785.1| Serine/threonine-protein kinase PBS1, putati... 62 6e-08 gb|EXB90894.1| Cysteine-rich receptor-like protein kinase 10 [Mo... 62 8e-08 ref|XP_002311515.2| hypothetical protein POPTR_0008s13160g [Popu... 62 8e-08 ref|XP_006390845.1| hypothetical protein EUTSA_v10018598mg [Eutr... 62 1e-07 ref|XP_004504576.1| PREDICTED: putative cysteine-rich receptor-l... 62 1e-07 ref|XP_004504575.1| PREDICTED: putative cysteine-rich receptor-l... 62 1e-07 ref|XP_006300487.1| hypothetical protein CARUB_v10020335mg [Caps... 62 1e-07 gb|AAG52342.1|AC011663_21 putative protein kinase; 29119-30743 [... 62 1e-07 ref|NP_177231.2| protein kinase family protein [Arabidopsis thal... 62 1e-07 >ref|XP_004297467.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Fragaria vesca subsp. vesca] Length = 428 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNLLGYCVH E+LLVY+YVVN+SLDK+L Sbjct: 103 VQHRNVVNLLGYCVHGVEKLLVYEYVVNESLDKLL 137 >ref|XP_004236943.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like isoform 2 [Solanum lycopersicum] Length = 339 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNLLGYCVH E+LLVY+YV N+SLDKIL Sbjct: 42 VQHRNVVNLLGYCVHGVEKLLVYEYVANESLDKIL 76 >ref|XP_004236942.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like isoform 1 [Solanum lycopersicum] Length = 399 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNLLGYCVH E+LLVY+YV N+SLDKIL Sbjct: 102 VQHRNVVNLLGYCVHGVEKLLVYEYVANESLDKIL 136 >ref|XP_004142276.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Cucumis sativus] gi|449527341|ref|XP_004170670.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Cucumis sativus] Length = 412 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNLLGYCVH E+LLVY+YV+N+SLDK+L Sbjct: 103 VQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLL 137 >ref|XP_006355074.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Solanum tuberosum] Length = 398 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNLLGYC+H E+LLVY+YV N+SLDKIL Sbjct: 101 VQHRNVVNLLGYCIHGVEKLLVYEYVANESLDKIL 135 >gb|EPS59620.1| hypothetical protein M569_15182 [Genlisea aurea] Length = 384 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 +QHRNVVNLLGYCVH ERLLVY+YV+N+SLDK+L Sbjct: 101 LQHRNVVNLLGYCVHGGERLLVYEYVLNESLDKLL 135 >ref|XP_006469213.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Citrus sinensis] Length = 404 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNLLGYC H E+LL+Y+YV+N+SLDK+L Sbjct: 103 VQHRNVVNLLGYCAHGAEKLLIYEYVINESLDKVL 137 >ref|XP_006448211.1| hypothetical protein CICLE_v10015463mg [Citrus clementina] gi|557550822|gb|ESR61451.1| hypothetical protein CICLE_v10015463mg [Citrus clementina] Length = 404 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNLLGYC H E+LL+Y+YV+N+SLDK+L Sbjct: 103 VQHRNVVNLLGYCAHGAEKLLIYEYVINESLDKVL 137 >gb|EYU33124.1| hypothetical protein MIMGU_mgv1a007864mg [Mimulus guttatus] Length = 393 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNL GYC+H E+LLVYQYV N+SLDK+L Sbjct: 101 VQHRNVVNLFGYCLHGAEKLLVYQYVANESLDKLL 135 >ref|XP_007045211.1| Cysteine-rich receptor-like protein kinase 10 [Theobroma cacao] gi|508709146|gb|EOY01043.1| Cysteine-rich receptor-like protein kinase 10 [Theobroma cacao] Length = 404 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNLLGYC H E+LLVY+YV N+SLDK+L Sbjct: 105 VQHRNVVNLLGYCAHGTEKLLVYEYVTNESLDKLL 139 >ref|XP_002315871.2| kinase family protein [Populus trichocarpa] gi|550329616|gb|EEF02042.2| kinase family protein [Populus trichocarpa] Length = 404 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNLLGYC H E+LLVY+YV N+SLDK+L Sbjct: 103 VQHRNVVNLLGYCAHGVEKLLVYEYVANESLDKLL 137 >ref|XP_002527785.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis] gi|223532820|gb|EEF34595.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis] Length = 411 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNLLGYC H E+LLVY+YV N+SLDK+L Sbjct: 103 VQHRNVVNLLGYCTHGMEKLLVYEYVSNESLDKLL 137 >gb|EXB90894.1| Cysteine-rich receptor-like protein kinase 10 [Morus notabilis] Length = 413 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNLLGYCVH E+LLVY+YV ++SLDK+L Sbjct: 104 VQHRNVVNLLGYCVHGSEKLLVYEYVPHESLDKLL 138 >ref|XP_002311515.2| hypothetical protein POPTR_0008s13160g [Populus trichocarpa] gi|550332964|gb|EEE88882.2| hypothetical protein POPTR_0008s13160g [Populus trichocarpa] Length = 393 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRN+VNLLGYC H E+LLVY+YV N+SLDK+L Sbjct: 103 VQHRNIVNLLGYCAHGVEKLLVYEYVANESLDKLL 137 >ref|XP_006390845.1| hypothetical protein EUTSA_v10018598mg [Eutrema salsugineum] gi|557087279|gb|ESQ28131.1| hypothetical protein EUTSA_v10018598mg [Eutrema salsugineum] Length = 427 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNL GYC H ++LLVY+YVVN+SLDK+L Sbjct: 113 VQHRNVVNLWGYCTHGDDKLLVYEYVVNESLDKVL 147 >ref|XP_004504576.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 35-like isoform X2 [Cicer arietinum] Length = 397 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNLLGYCVH E+LLVY+YV ++SLDK+L Sbjct: 103 VQHRNVVNLLGYCVHGTEKLLVYEYVPHESLDKLL 137 >ref|XP_004504575.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 35-like isoform X1 [Cicer arietinum] Length = 402 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNLLGYCVH E+LLVY+YV ++SLDK+L Sbjct: 103 VQHRNVVNLLGYCVHGTEKLLVYEYVPHESLDKLL 137 >ref|XP_006300487.1| hypothetical protein CARUB_v10020335mg [Capsella rubella] gi|482569197|gb|EOA33385.1| hypothetical protein CARUB_v10020335mg [Capsella rubella] Length = 427 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNL GYC H ++LLVY+YVVN+SLDK+L Sbjct: 113 VQHRNVVNLWGYCTHGDDKLLVYEYVVNESLDKVL 147 >gb|AAG52342.1|AC011663_21 putative protein kinase; 29119-30743 [Arabidopsis thaliana] Length = 381 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNL GYC H ++LLVY+YVVN+SLDK+L Sbjct: 69 VQHRNVVNLWGYCTHGDDKLLVYEYVVNESLDKVL 103 >ref|NP_177231.2| protein kinase family protein [Arabidopsis thaliana] gi|193870477|gb|ACF22895.1| At1g70740 [Arabidopsis thaliana] gi|332196987|gb|AEE35108.1| protein kinase family protein [Arabidopsis thaliana] Length = 425 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 403 VQHRNVVNLLGYCVHAQERLLVYQYVVNQSLDKIL 299 VQHRNVVNL GYC H ++LLVY+YVVN+SLDK+L Sbjct: 113 VQHRNVVNLWGYCTHGDDKLLVYEYVVNESLDKVL 147