BLASTX nr result
ID: Mentha26_contig00043734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043734 (639 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38949.1| hypothetical protein MIMGU_mgv1a024102mg [Mimulus... 57 5e-06 gb|EYU29777.1| hypothetical protein MIMGU_mgv1a008457mg [Mimulus... 57 6e-06 >gb|EYU38949.1| hypothetical protein MIMGU_mgv1a024102mg [Mimulus guttatus] Length = 469 Score = 57.0 bits (136), Expect = 5e-06 Identities = 46/113 (40%), Positives = 60/113 (53%), Gaps = 2/113 (1%) Frame = -1 Query: 333 SGVEVRGDADLMLKRLSIYGHGSVKSMRISAPNLTFLGI-DTEQSVNLLLENVPKLAAAD 157 S +EV G + L LK L + +KS+++SAPNL L I D E LLLENVP L Sbjct: 239 SNLEVCGSS-LALKHLKLKSCYDLKSVKVSAPNLASLSILDAE---GLLLENVPALVKVS 294 Query: 156 FRFVSGKPNGGRNLASVLLCLSSQLEILSLTL-QYSEVFLAKGFPLMPNLKKL 1 + + + +NL L C QLEILSL L + + FP +P LKKL Sbjct: 295 VTSIIDQYSV-KNLLPTLSCCIFQLEILSLNLDDHGKKIFLPMFPQLPKLKKL 346 >gb|EYU29777.1| hypothetical protein MIMGU_mgv1a008457mg [Mimulus guttatus] Length = 373 Score = 56.6 bits (135), Expect = 6e-06 Identities = 45/116 (38%), Positives = 64/116 (55%), Gaps = 5/116 (4%) Frame = -1 Query: 333 SGVEVRGDADLMLKRLSIYGHGSVKSMRISAPNLTFLGIDTEQSVNLLLENVPKLAAADF 154 S VEV G + L+LKRL I ++K +R+SAPNL L + ++ L+LENVP L Sbjct: 138 SNVEVCGSS-LVLKRLEICYCRNLKLVRVSAPNLVSLTV--QELEELILENVPMLVELSL 194 Query: 153 RFVSGKPNGGRNLASVLLCLSSQLEILSLTLQYSEVFLAKG-----FPLMPNLKKL 1 + G+ + G L + C + QLE+L+L + + KG FP MP LKKL Sbjct: 195 PWGFGEIS-GEKLCDAISCCNLQLEVLTLKVLQNP---KKGIELCEFPEMPRLKKL 246