BLASTX nr result
ID: Mentha26_contig00043662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043662 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006650942.1| PREDICTED: uncharacterized protein LOC102703... 55 8e-06 >ref|XP_006650942.1| PREDICTED: uncharacterized protein LOC102703022 [Oryza brachyantha] Length = 1781 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 2 QLGIVRSLNVHVSGALALWEYTRQQRLHPKMP 97 QLGIVRSLNVHVSGA+A+WEYTRQQRL P Sbjct: 1748 QLGIVRSLNVHVSGAIAVWEYTRQQRLAAAEP 1779