BLASTX nr result
ID: Mentha26_contig00043637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043637 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006449552.1| hypothetical protein CICLE_v10016666mg [Citr... 171 1e-40 gb|EYU28119.1| hypothetical protein MIMGU_mgv1a013597mg [Mimulus... 170 2e-40 ref|XP_006467606.1| PREDICTED: ER lumen protein retaining recept... 170 2e-40 ref|NP_001235015.1| uncharacterized protein LOC100306692 [Glycin... 165 7e-39 ref|XP_007025304.1| ER lumen protein retaining receptor family p... 164 1e-38 ref|XP_002267990.1| PREDICTED: ER lumen protein retaining recept... 164 1e-38 ref|NP_001236222.1| uncharacterized protein LOC100526936 [Glycin... 163 3e-38 ref|XP_002522261.1| er lumen protein retaining receptor, putativ... 163 3e-38 ref|XP_004134621.1| PREDICTED: ER lumen protein retaining recept... 162 3e-38 gb|EXC10949.1| ER lumen protein retaining receptor [Morus notabi... 162 5e-38 gb|ADI60302.1| ER luminal protein receptor 2a [Nicotiana bentham... 162 5e-38 ref|XP_004233064.1| PREDICTED: ER lumen protein retaining recept... 162 6e-38 ref|XP_007159486.1| hypothetical protein PHAVU_002G241500g [Phas... 160 1e-37 ref|XP_004155536.1| PREDICTED: LOW QUALITY PROTEIN: ER lumen pro... 160 1e-37 ref|XP_004504277.1| PREDICTED: ER lumen protein retaining recept... 160 2e-37 gb|ACD56623.1| ERD2-like protein [Gossypium raimondii] 160 2e-37 gb|ADN34026.1| ER lumen protein retaining receptor [Cucumis melo... 159 3e-37 ref|XP_006358100.1| PREDICTED: ER lumen protein retaining recept... 159 5e-37 gb|EPS74562.1| hypothetical protein M569_00193, partial [Genlise... 158 7e-37 ref|NP_564326.1| ER lumen protein retaining receptor [Arabidopsi... 157 1e-36 >ref|XP_006449552.1| hypothetical protein CICLE_v10016666mg [Citrus clementina] gi|557552163|gb|ESR62792.1| hypothetical protein CICLE_v10016666mg [Citrus clementina] Length = 215 Score = 171 bits (433), Expect = 1e-40 Identities = 79/99 (79%), Positives = 93/99 (93%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSGISLKTQELYA+VFLTRYLDLFT+FISVYNT MK+VFIASSLAIVW MR RA+RR+ Sbjct: 28 SCSGISLKTQELYALVFLTRYLDLFTDFISVYNTVMKLVFIASSLAIVWCMRMHRAVRRT 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YD++LDTFRHYFL+ ACFLL+L++NEK++ QE+FWAFSI Sbjct: 88 YDKELDTFRHYFLIAACFLLSLILNEKFTFQEIFWAFSI 126 >gb|EYU28119.1| hypothetical protein MIMGU_mgv1a013597mg [Mimulus guttatus] Length = 215 Score = 170 bits (430), Expect = 2e-40 Identities = 81/99 (81%), Positives = 89/99 (89%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSGISLKTQELY IVFL RYLDLFT+FISVYNT MK+VFI SSLAIVW MRF R ++RS Sbjct: 28 SCSGISLKTQELYGIVFLARYLDLFTDFISVYNTVMKLVFIGSSLAIVWCMRFHRVVKRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YDRD+DTFRHYFLVG CFLLAL V+EK+S +EVFWAFSI Sbjct: 88 YDRDVDTFRHYFLVGGCFLLALFVHEKFSFREVFWAFSI 126 >ref|XP_006467606.1| PREDICTED: ER lumen protein retaining receptor-like [Citrus sinensis] Length = 215 Score = 170 bits (430), Expect = 2e-40 Identities = 78/99 (78%), Positives = 93/99 (93%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSGISLKTQELYA+VFLTRYLDLFT+FISVYNT MK+VFIASSLAIVW MR RA+RR+ Sbjct: 28 SCSGISLKTQELYALVFLTRYLDLFTDFISVYNTVMKLVFIASSLAIVWCMRMHRAVRRT 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YD++LDTFRHYFL+ ACF+L+L++NEK++ QE+FWAFSI Sbjct: 88 YDKELDTFRHYFLIAACFVLSLILNEKFTFQEIFWAFSI 126 >ref|NP_001235015.1| uncharacterized protein LOC100306692 [Glycine max] gi|255629293|gb|ACU14991.1| unknown [Glycine max] Length = 215 Score = 165 bits (417), Expect = 7e-39 Identities = 80/99 (80%), Positives = 90/99 (90%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSGIS KTQELYAIVF+ RYLDLFT+FISVYNT MKVVFIASSLAIVW MRF +RRS Sbjct: 28 SCSGISRKTQELYAIVFVARYLDLFTDFISVYNTFMKVVFIASSLAIVWCMRFHPMVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YDR+LDTFRHYFLVGA F LAL+++EK++VQE+FWAFSI Sbjct: 88 YDRELDTFRHYFLVGASFALALILHEKFTVQEIFWAFSI 126 >ref|XP_007025304.1| ER lumen protein retaining receptor family protein [Theobroma cacao] gi|508780670|gb|EOY27926.1| ER lumen protein retaining receptor family protein [Theobroma cacao] Length = 215 Score = 164 bits (415), Expect = 1e-38 Identities = 78/99 (78%), Positives = 91/99 (91%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSGISLKTQELYA+VFLTRYLDLFT+FISVYNT MK+VFIASSLAIVW MR R +RRS Sbjct: 28 SCSGISLKTQELYALVFLTRYLDLFTDFISVYNTIMKLVFIASSLAIVWCMRMHRVVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YD+++DTFRHYFL+ A FLLA+LV+EK++ QE+FWAFSI Sbjct: 88 YDKEIDTFRHYFLILASFLLAVLVHEKFTFQEIFWAFSI 126 >ref|XP_002267990.1| PREDICTED: ER lumen protein retaining receptor [Vitis vinifera] gi|297740541|emb|CBI30723.3| unnamed protein product [Vitis vinifera] Length = 215 Score = 164 bits (415), Expect = 1e-38 Identities = 78/99 (78%), Positives = 88/99 (88%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSGISLKTQELYA+VFLTRYLDLFT+FISVYNT MK+VFI SSLAIVW MR R ++RS Sbjct: 28 SCSGISLKTQELYALVFLTRYLDLFTDFISVYNTVMKLVFIGSSLAIVWCMRMHRTVKRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YD LDTFRHYFLV ACFL AL+V+EK++ QE+FWAFSI Sbjct: 88 YDGQLDTFRHYFLVAACFLSALIVHEKFTFQEIFWAFSI 126 >ref|NP_001236222.1| uncharacterized protein LOC100526936 [Glycine max] gi|255631185|gb|ACU15958.1| unknown [Glycine max] Length = 215 Score = 163 bits (412), Expect = 3e-38 Identities = 79/99 (79%), Positives = 88/99 (88%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSGIS KTQELYAIVF+ RYLDLFT+FISVYNT MKVVFIASSLAI W MRF +RR Sbjct: 28 SCSGISRKTQELYAIVFVARYLDLFTDFISVYNTFMKVVFIASSLAIFWCMRFHPMVRRG 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YDRDLDTFRHYFLVGA F LAL+++EK++VQE+FWAFSI Sbjct: 88 YDRDLDTFRHYFLVGASFALALILHEKFTVQEIFWAFSI 126 >ref|XP_002522261.1| er lumen protein retaining receptor, putative [Ricinus communis] gi|223538514|gb|EEF40119.1| er lumen protein retaining receptor, putative [Ricinus communis] Length = 215 Score = 163 bits (412), Expect = 3e-38 Identities = 77/99 (77%), Positives = 90/99 (90%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSGISLKTQELYA+VFLTRYLDLFT+FIS+YN MKVVFIASSLAIVW MR R ++RS Sbjct: 28 SCSGISLKTQELYALVFLTRYLDLFTDFISLYNYVMKVVFIASSLAIVWCMRRHRVVKRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YD++LDTFRHYFLV ACF+LAL V+EK++ +E+FWAFSI Sbjct: 88 YDKELDTFRHYFLVAACFVLALFVHEKFTFREIFWAFSI 126 >ref|XP_004134621.1| PREDICTED: ER lumen protein retaining receptor-like [Cucumis sativus] Length = 215 Score = 162 bits (411), Expect = 3e-38 Identities = 76/99 (76%), Positives = 88/99 (88%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSGISLKTQELYA+VFLTRYLDLFT+FIS+YNT MK++FIASSLAIVW MR +RRS Sbjct: 28 SCSGISLKTQELYALVFLTRYLDLFTDFISIYNTVMKIIFIASSLAIVWCMRVHPIVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YD+DLDTFR+YF+V F+LALLVNEK+ QE+FWAFSI Sbjct: 88 YDKDLDTFRYYFIVAGSFILALLVNEKFGFQEIFWAFSI 126 >gb|EXC10949.1| ER lumen protein retaining receptor [Morus notabilis] Length = 215 Score = 162 bits (410), Expect = 5e-38 Identities = 77/99 (77%), Positives = 91/99 (91%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSGISLKTQELYA+VFLTRYLDLFT+FIS+YNT MK+VFI SSLAIVW MR D A+RR+ Sbjct: 28 SCSGISLKTQELYALVFLTRYLDLFTDFISLYNTLMKLVFITSSLAIVWCMRGDPAVRRT 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YD+++DTFRHYFLV CF+LALL++EK++VQEV WAFSI Sbjct: 88 YDKEIDTFRHYFLVLGCFVLALLLHEKFTVQEVLWAFSI 126 >gb|ADI60302.1| ER luminal protein receptor 2a [Nicotiana benthamiana] Length = 215 Score = 162 bits (410), Expect = 5e-38 Identities = 77/99 (77%), Positives = 90/99 (90%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSGISLKTQELYAIVFL RYLDLF++FIS+YNT MK+VFI SSLAIVW MR+ R +RRS Sbjct: 28 SCSGISLKTQELYAIVFLARYLDLFSDFISLYNTVMKLVFIGSSLAIVWCMRYHRVVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YDR+LDTFR++ LVGACF LAL+++EK+S QEVFWAFSI Sbjct: 88 YDRELDTFRYWILVGACFTLALVLHEKFSFQEVFWAFSI 126 >ref|XP_004233064.1| PREDICTED: ER lumen protein retaining receptor-like [Solanum lycopersicum] Length = 215 Score = 162 bits (409), Expect = 6e-38 Identities = 75/99 (75%), Positives = 92/99 (92%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSGISLKTQELYAIVF+ RYLDLFT+FIS+YNT MK+VFI SSLAIVW MR+ R +RRS Sbjct: 28 SCSGISLKTQELYAIVFVARYLDLFTDFISLYNTVMKLVFIGSSLAIVWCMRYHRVVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YDR+LDTFR++ L+GACF+LAL+++EK+++QEVFWAFSI Sbjct: 88 YDRELDTFRYWILLGACFVLALVLHEKFTLQEVFWAFSI 126 >ref|XP_007159486.1| hypothetical protein PHAVU_002G241500g [Phaseolus vulgaris] gi|561032901|gb|ESW31480.1| hypothetical protein PHAVU_002G241500g [Phaseolus vulgaris] Length = 215 Score = 160 bits (406), Expect = 1e-37 Identities = 79/99 (79%), Positives = 89/99 (89%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSG+S KTQELYAIVF+ RYLDLFT+FISVYNT MKVVFIASSLAIVW MRF +RRS Sbjct: 28 SCSGVSRKTQELYAIVFIFRYLDLFTDFISVYNTFMKVVFIASSLAIVWCMRFHPVVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YDR+LDTFR++FLVGA F LAL+ +EK+SVQEVFWAFSI Sbjct: 88 YDRELDTFRYFFLVGASFALALIWHEKFSVQEVFWAFSI 126 >ref|XP_004155536.1| PREDICTED: LOW QUALITY PROTEIN: ER lumen protein retaining receptor-like [Cucumis sativus] Length = 215 Score = 160 bits (406), Expect = 1e-37 Identities = 75/99 (75%), Positives = 87/99 (87%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSGISLKTQELYA+VF TRYLDLFT+FIS+YNT MK++FIASSLAIVW MR +RRS Sbjct: 28 SCSGISLKTQELYALVFXTRYLDLFTDFISIYNTVMKIIFIASSLAIVWCMRVHPIVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YD+DLDTFR+YF+V F+LALLVNEK+ QE+FWAFSI Sbjct: 88 YDKDLDTFRYYFIVAGSFILALLVNEKFGFQEIFWAFSI 126 >ref|XP_004504277.1| PREDICTED: ER lumen protein retaining receptor-like [Cicer arietinum] Length = 215 Score = 160 bits (404), Expect = 2e-37 Identities = 76/99 (76%), Positives = 88/99 (88%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSG+S KTQELYAIVFL RYLDLFT+FISVYNT MKVVFI SSLAIVW MR +RRS Sbjct: 28 SCSGVSRKTQELYAIVFLARYLDLFTDFISVYNTFMKVVFIVSSLAIVWCMRVHPLVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YD+DLDTFRHYFL+GA F+LAL+++EK++ QE+FWAFSI Sbjct: 88 YDKDLDTFRHYFLIGATFVLALVLHEKFTFQEIFWAFSI 126 >gb|ACD56623.1| ERD2-like protein [Gossypium raimondii] Length = 215 Score = 160 bits (404), Expect = 2e-37 Identities = 76/99 (76%), Positives = 88/99 (88%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSGISLKTQELYA+VFL RYLDLFT+F+SVYNT MKVVFI SS+AIVW MR DR +RRS Sbjct: 28 SCSGISLKTQELYALVFLARYLDLFTDFVSVYNTVMKVVFIVSSVAIVWCMRVDRIVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YD+DLDTFRH+FL+ FLLALLV+EK++ QE+FWA SI Sbjct: 88 YDKDLDTFRHHFLILTSFLLALLVHEKFTFQEIFWAVSI 126 >gb|ADN34026.1| ER lumen protein retaining receptor [Cucumis melo subsp. melo] Length = 215 Score = 159 bits (403), Expect = 3e-37 Identities = 76/99 (76%), Positives = 86/99 (86%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSGISLKTQELYA+VFLTRYLDLFT+FIS YNT MK++FIASSLAIVW MR +RRS Sbjct: 28 SCSGISLKTQELYALVFLTRYLDLFTDFISFYNTVMKIIFIASSLAIVWCMRVHPIVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YD+DLDTFR+YFLV +LALLVNEK+ QE+FWAFSI Sbjct: 88 YDKDLDTFRYYFLVAGSLILALLVNEKFGFQEIFWAFSI 126 >ref|XP_006358100.1| PREDICTED: ER lumen protein retaining receptor-like [Solanum tuberosum] Length = 215 Score = 159 bits (401), Expect = 5e-37 Identities = 74/99 (74%), Positives = 91/99 (91%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SCSGISLKTQELYAIVF+TRYLDLFT+FIS+YNT MK+VFI SSLAIVW MR+ R +RRS Sbjct: 28 SCSGISLKTQELYAIVFVTRYLDLFTDFISLYNTVMKLVFIGSSLAIVWCMRYHRVVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YDR+LDTFR++ L+G F+LAL+++EK+++QEVFWAFSI Sbjct: 88 YDRELDTFRYWILLGVSFILALVLHEKFTLQEVFWAFSI 126 >gb|EPS74562.1| hypothetical protein M569_00193, partial [Genlisea aurea] Length = 153 Score = 158 bits (400), Expect = 7e-37 Identities = 75/97 (77%), Positives = 85/97 (87%) Frame = +3 Query: 9 SGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRSYD 188 SG+SLKTQELYAIVFL RYLDLFT+FIS+YNT MK++FI SSLAIVW MRF R +RRSYD Sbjct: 1 SGVSLKTQELYAIVFLARYLDLFTDFISIYNTVMKLIFIGSSLAIVWCMRFHRVVRRSYD 60 Query: 189 RDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 RDLDTFRHYFLVG LLAL ++EK++ QEV WAFSI Sbjct: 61 RDLDTFRHYFLVGFSLLLALFIHEKFTFQEVLWAFSI 97 >ref|NP_564326.1| ER lumen protein retaining receptor [Arabidopsis thaliana] gi|544250|sp|P35402.1|ERD2_ARATH RecName: Full=ER lumen protein retaining receptor; AltName: Full=HDEL receptor gi|9502409|gb|AAF88108.1|AC021043_1 endoplasmic reticulum retention receptor Erd2 [Arabidopsis thaliana] gi|12323512|gb|AAG51724.1|AC068667_3 ER lumen protein retaining receptor; 3333-1007 [Arabidopsis thaliana] gi|20260682|gb|AAM13239.1| ER lumen protein retaining receptor; 3333-1007 [Arabidopsis thaliana] gi|32189301|gb|AAP75805.1| At1g29330 [Arabidopsis thaliana] gi|332192952|gb|AEE31073.1| ER lumen protein retaining receptor [Arabidopsis thaliana] Length = 215 Score = 157 bits (397), Expect = 1e-36 Identities = 73/99 (73%), Positives = 90/99 (90%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTEFISVYNTTMKVVFIASSLAIVWYMRFDRAIRRS 182 SC+GISLKTQELYA+VFLTRYLDLFT+++S+YN+ MK+VFIASSLAIVW MR +RRS Sbjct: 28 SCAGISLKTQELYALVFLTRYLDLFTDYVSLYNSIMKIVFIASSLAIVWCMRRHPLVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEVFWAFSI 299 YD+DLDTFRH ++V ACF+L L++NEK++VQEVFWAFSI Sbjct: 88 YDKDLDTFRHQYVVLACFVLGLILNEKFTVQEVFWAFSI 126