BLASTX nr result
ID: Mentha26_contig00043612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043612 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40931.1| hypothetical protein MIMGU_mgv1a0134081mg, partia... 62 6e-08 >gb|EYU40931.1| hypothetical protein MIMGU_mgv1a0134081mg, partial [Mimulus guttatus] gi|604341686|gb|EYU40932.1| hypothetical protein MIMGU_mgv1a018676mg [Mimulus guttatus] Length = 137 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +1 Query: 187 MGALAFDTTIMCPLDYVSLGLKDPIKDYLGKPRVLSLLST 306 MG+LA + I+ LDY+SLGLKDPIKDY+GKPRVLSL+ST Sbjct: 1 MGSLALEKEIIGSLDYISLGLKDPIKDYIGKPRVLSLVST 40